P15RS Antibody

Images

 
Western Blot: P15RS Antibody [NBP1-87917] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: P15RS Antibody [NBP1-87917] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus & the Golgi apparatus.
Immunohistochemistry-Paraffin: P15RS Antibody [NBP1-87917] - Staining of human colon shows strong nuclear positivity in glandular cells.
Western Blot: P15RS Antibody [NBP1-87917] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, Rt, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, ICC, IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

P15RS Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VIVEAFKHVSSETDESCKKHLGRVLSIWEERSVYENDVLEQLKQALYGDKKPRKRTYEQIKVDENENCSSLGSPSEPPQTL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RPRD1A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Immunocytochemistry
  • Immunofluorescence
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
P15RS Protein (NBP1-87917PEP)
Publications
Read Publication using NBP1-87917.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for P15RS Antibody

  • Cyclin-dependent kinase inhibitor 2B-related protein (p15INK4B-related protein)
  • Cyclin-dependent kinase inhibitor 2B-related protein
  • FLJ10656
  • HsT3101
  • MGC19513
  • p15INK4B-related protein
  • P15RScyclin-dependent kinase 2B-inhibitor-related protein
  • regulation of nuclear pre-mRNA domain containing 1A
  • regulation of nuclear pre-mRNA domain-containing protein 1A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB6798
Species: Hu
Applications: WB, ICC
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-82805
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00029107-M08
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1620
Species: Mu
Applications: WB, IHC
H00006925-M03
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
H00006934-M06
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-57432
Species: Hu
Applications: WB, ICC/IF
AF953
Species: Hu
Applications: WB, Simple Western, IHC, IP
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NBP2-45634
Species: Hu
Applications: WB, IHC
NB100-367
Species: Hu
Applications: WB, IP
NBP1-82031
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for P15RS Antibody (NBP1-87917)(1)

Reviews for P15RS Antibody (NBP1-87917) (0)

There are no reviews for P15RS Antibody (NBP1-87917). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for P15RS Antibody (NBP1-87917) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional P15RS Products

Bioinformatics Tool for P15RS Antibody (NBP1-87917)

Discover related pathways, diseases and genes to P15RS Antibody (NBP1-87917). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for P15RS Antibody (NBP1-87917)

Discover more about diseases related to P15RS Antibody (NBP1-87917).
 

Pathways for P15RS Antibody (NBP1-87917)

View related products by pathway.

PTMs for P15RS Antibody (NBP1-87917)

Learn more about PTMs related to P15RS Antibody (NBP1-87917).

Blogs on P15RS

There are no specific blogs for P15RS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our P15RS Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RPRD1A