RTN3 Antibody

Images

 
Independent Antibodies: Immunohistochemistry-Paraffin: RTN3 Antibody [NBP1-88871] - Staining of human cerebral cortex, colon, liver and lymph node using Anti-RTN3 antibody (A) NBP1-88871 shows similar protein ...read more
Immunocytochemistry/ Immunofluorescence: RTN3 Antibody [NBP1-88871] - Staining of human cell line U-2 OS shows localization to endoplasmic reticulum. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: RTN3 Antibody [NBP1-88871] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: RTN3 Antibody [NBP1-88871] - Staining of human colon shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: RTN3 Antibody [NBP1-88871] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: RTN3 Antibody [NBP1-88871] - Staining of human lymph node shows no positivity in lymphoid cells as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

RTN3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: IMTSSFLSSSEIHNTGLTILHGEKSHVLGSQPILAKEGKDHLDLLDMKKMEKPQGTSNNVSDSSVSLAAGVHCDRPSIPASFPEHPAFLSKKIGQVEEQIDKETKNPNGVSSREAKTALDADDRFTLLTAQKPPTEY
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RTN3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RTN3 Protein (NBP1-88871PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RTN3 Antibody

  • ASYIPASY interacting protein
  • HAP
  • isoforme III
  • isoforme VI
  • Neuroendocrine-specific protein-like 2
  • Neuroendocrine-specific protein-like II
  • NSPL2NSP-like protein II
  • NSPLIIhomolog of ASY protein
  • NSP-like protein 2
  • reticulon 3
  • reticulon-3
  • RTN3-A1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56681
Species: Hu, Mu, Rb, Rt, Sh
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
NB110-74569
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP2-47525
Species: Hu
Applications: IHC, IHC-P, WB
H00006690-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-19533
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00000053-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
NBP1-86658
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-67635
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IP, WB
H00055835-M02
Species: Hu
Applications: ELISA, IP, S-ELISA, WB
7754-BH/CF
Species: Hu
Applications: BA
NBP1-82847
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-19535
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
NBP1-92450
Species: Hu
Applications: IHC, IHC-P
396-HB/CF
Species: Hu
Applications: BA
NB100-116
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ChIP, ELISA, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, PLA, Simple Western, WB
NBL1-14964
Species: Hu
Applications: WB
NBP1-88871
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for RTN3 Antibody (NBP1-88871) (0)

There are no publications for RTN3 Antibody (NBP1-88871).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RTN3 Antibody (NBP1-88871) (0)

There are no reviews for RTN3 Antibody (NBP1-88871). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RTN3 Antibody (NBP1-88871) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RTN3 Products

Bioinformatics Tool for RTN3 Antibody (NBP1-88871)

Discover related pathways, diseases and genes to RTN3 Antibody (NBP1-88871). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RTN3 Antibody (NBP1-88871)

Discover more about diseases related to RTN3 Antibody (NBP1-88871).
 

Pathways for RTN3 Antibody (NBP1-88871)

View related products by pathway.

PTMs for RTN3 Antibody (NBP1-88871)

Learn more about PTMs related to RTN3 Antibody (NBP1-88871).

Blogs on RTN3

There are no specific blogs for RTN3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RTN3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RTN3