RTN3 Antibody - BSA Free

Immunohistochemistry-Paraffin: RTN3 Antibody [NBP1-88871] - Staining of human cerebral cortex, colon, liver and lymph node using Anti-RTN3 antibody (A) NBP1-88871 shows similar protein distribution across tissues to independent antibody NBP1-88870 (B).

Immunocytochemistry/Immunofluorescence: RTN3 Antibody [NBP1-88871] - Staining of human cell line U-2 OS shows localization to endoplasmic reticulum. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: RTN3 Antibody [NBP1-88871] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: RTN3 Antibody [NBP1-88871] - Staining of human colon shows no positivity in glandular cells as expected.

Immunohistochemistry-Paraffin: RTN3 Antibody [NBP1-88871] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: RTN3 Antibody [NBP1-88871] - Staining of human lymph node shows no positivity in lymphoid cells as expected.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RTN3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RTN3 Antibody - BSA Free (NBP1-88871) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: IMTSSFLSSSEIHNTGLTILHGEKSHVLGSQPILAKEGKDHLDLLDMKKMEKPQGTSNNVSDSSVSLAAGVHCDRPSIPASFPEHPAFLSKKIGQVEEQIDKETKNPNGVSSREAKTALDADDRFTLLTAQKPPTEY
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RTN3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RTN3 Protein (NBP1-88871PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RTN3 Antibody - BSA Free

• ASYIPASY interacting protein
• HAP
• isoforme III
• isoforme VI
• Neuroendocrine-specific protein-like 2
• Neuroendocrine-specific protein-like II
• NSPL2NSP-like protein II
• NSPLIIhomolog of ASY protein
• NSP-like protein 2
• reticulon 3
• reticulon-3
• RTN3-A1

Background

May be involved in membrane trafficking in the early secretory pathway. Inhibits BACE1 activity and amyloid precursor protein processing. May induce caspase-8 cascade and apoptosis. May favor BCL2 translocation to the mitochondria upon endoplasmic reticulum stress. In case of enteroviruses infection, RTN3 may be involved in the viral replication or pathogenesis. There are 5 isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RTN3