RECQL5 Antibody

Images

 
Genetic Strategies: Western Blot: RECQL5 Antibody [NBP1-83438] - Analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-RECQL5 antibody. Remaining relative ...read more
Immunocytochemistry/ Immunofluorescence: RECQL5 Antibody [NBP1-83438] - Staining of human cell line A-431 shows localization to nucleus & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: RECQL5 Antibody [NBP1-83438] - Staining of human placenta shows no positivity in stromal cells as expected.
Immunohistochemistry-Paraffin: RECQL5 Antibody [NBP1-83438] - Staining of human testis shows moderate to strong nuclear positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: RECQL5 Antibody [NBP1-83438] - Staining of human cervix, uterine shows moderate to strong nuclear positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: RECQL5 Antibody [NBP1-83438] - Staining of human cerebral cortex shows moderate to strong nuclear positivity in neurons.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

RECQL5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ELEHETFRNAKVANLYKASVLKKVADIHRASKDGQPYDMGGSAKSCSAQAEPPEPNEYDIPPASHVYSLKPKRVGAGFPKGSCPFQTATELMETTRIREQ
Specificity
Specificity of human RECQL5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RECQL5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Publications
Read Publications using NBP1-83438.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RECQL5 Antibody

  • DNA helicase, RecQ-like type 5
  • EC 3.6.1
  • EC 3.6.4.12
  • FLJ90603
  • RecQ protein-like 5ATP-dependent DNA helicase Q5
  • RecQ5
  • RECQ5RecQ protein 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-214
Species: Hu, Mu
Applications: WB, IP
NB100-471
Species: Hu
Applications: WB, ICC/IF, IHC, IP, ChIP
NB100-619
Species: Hu
Applications: WB, IHC, IHC-P, IP
25470002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB100-148
Species: Hu, Mu, Rt, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, KD
NBP2-13962
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56326
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-598
Species: Hu, Mu, Ye, Pm(-)
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IP, CyTOF-ready, Flow-IC
NB100-215
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-84916
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-1768
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22360
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-150
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NB100-56546
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-33169
Species: Hu, Mu
Applications: WB
NB600-809
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA
NB100-77334
Species: Hu
Applications: WB, Flow, PEP-ELISA, KD
NBP1-86337
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P

Publications for RECQL5 Antibody (NBP1-83438)(2)

We have publications tested in 2 applications: IHC, WB.


Filter By Application
IHC
(1)
WB
(1)
All Applications
Filter By Species
All Species

Reviews for RECQL5 Antibody (NBP1-83438) (0)

There are no reviews for RECQL5 Antibody (NBP1-83438). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RECQL5 Antibody (NBP1-83438) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RECQL5 Products

Bioinformatics Tool for RECQL5 Antibody (NBP1-83438)

Discover related pathways, diseases and genes to RECQL5 Antibody (NBP1-83438). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RECQL5 Antibody (NBP1-83438)

Discover more about diseases related to RECQL5 Antibody (NBP1-83438).
 

Pathways for RECQL5 Antibody (NBP1-83438)

View related products by pathway.

PTMs for RECQL5 Antibody (NBP1-83438)

Learn more about PTMs related to RECQL5 Antibody (NBP1-83438).

Blogs on RECQL5

There are no specific blogs for RECQL5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RECQL5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RECQL5