RPRD2 Antibody


Immunocytochemistry/ Immunofluorescence: RPRD2 Antibody [NBP2-56292] - Staining of human cell line SiHa shows localization to nucleoplasm & vesicles.
Immunohistochemistry-Paraffin: RPRD2 Antibody [NBP2-56292] - Staining of human bronchus shows strong nuclear positivity in respiratory epithelial cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

RPRD2 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PEESPVPSPSMDAPSPTGSESPFQGMGGEESQSPTMESEKSATPEPVTDNRDVEDMELSDVEDDGSKIIVEDRKEKPAEKSAVSTSVPTKPTENIS
Specificity of human RPRD2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (94%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for RPRD2 Antibody

  • HSPC099
  • KIAA0460FLJ32145
  • regulation of nuclear pre-mRNA domain containing 2
  • regulation of nuclear pre-mRNA domain-containing protein 2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ye, Ze
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RPRD2 Antibody (NBP2-56292) (0)

There are no publications for RPRD2 Antibody (NBP2-56292).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPRD2 Antibody (NBP2-56292) (0)

There are no reviews for RPRD2 Antibody (NBP2-56292). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RPRD2 Antibody (NBP2-56292) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional RPRD2 Products

Bioinformatics Tool for RPRD2 Antibody (NBP2-56292)

Discover related pathways, diseases and genes to RPRD2 Antibody (NBP2-56292). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

PTMs for RPRD2 Antibody (NBP2-56292)

Learn more about PTMs related to RPRD2 Antibody (NBP2-56292).

Research Areas for RPRD2 Antibody (NBP2-56292)

Find related products by research area.

Blogs on RPRD2

There are no specific blogs for RPRD2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RPRD2 Antibody and receive a gift card or discount.


Gene Symbol RPRD2