RNF113A Antibody

Images

 
Immunohistochemistry-Paraffin: RNF113A Antibody [NBP1-85378] - Staining of human gall bladder shows nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RNF113A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GSSSDEGCTVVRPEKKRVTHNPMIQKTRDSGKQKAAYGDLSSEEEEENEPESLGVVYKSTRSAKPVGPEDMGATAVYELDTEKERDAQAIFERSQKIQEELRGKEDDKIYR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RNF113A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RNF113A Protein (NBP1-85378PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RNF113A Antibody

  • ring finger protein 113A
  • RNF113Cwc24
  • zinc finger protein 183 (RING finger, C3HC4 type)
  • Zinc finger protein 183
  • ZNF183

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00055922-M06
Species: Hu
Applications: WB, ELISA
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP2-49127
Species: Hu
Applications: IHC
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-49381
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-92692
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
AF856
Species: Mu
Applications: WB, Flow, CyTOF-ready, Neut
NB100-79848
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-32731
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-20367
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00008175-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP2-13920
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB7185
Species: Hu
Applications: WB, Simple Western
DDX0700P-100
Species: Hu, Ca
Applications: B/N, Flow, IP
NBP2-33583
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-610
Species: Hu, Ca, GP
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP
NBP2-20039
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1008
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-85378
Species: Hu, Mu
Applications: IHC, IHC-P

Publications for RNF113A Antibody (NBP1-85378) (0)

There are no publications for RNF113A Antibody (NBP1-85378).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNF113A Antibody (NBP1-85378) (0)

There are no reviews for RNF113A Antibody (NBP1-85378). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RNF113A Antibody (NBP1-85378) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RNF113A Products

Bioinformatics Tool for RNF113A Antibody (NBP1-85378)

Discover related pathways, diseases and genes to RNF113A Antibody (NBP1-85378). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNF113A Antibody (NBP1-85378)

Discover more about diseases related to RNF113A Antibody (NBP1-85378).
 

Pathways for RNF113A Antibody (NBP1-85378)

View related products by pathway.

Research Areas for RNF113A Antibody (NBP1-85378)

Find related products by research area.

Blogs on RNF113A

There are no specific blogs for RNF113A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RNF113A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RNF113A