![Western Blot: CCT6A Antibody [NBP2-46715] - Analysis in human cell lines A-431 and MCF-7 using anti-CCT6A antibody. Corresponding CCT6A RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.](http://images.novusbio.com/fullsize/CCT6A-Antibody-Western-Blot-NBP2-46715-img0008.jpg "Western Blot: CCT6A Antibody [NBP2-46715] - Analysis in human cell lines A-431 and MCF-7 using anti-CCT6A antibody. Corresponding CCT6A RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RGLQDVLRTNLGPKGTMKMLVSGAGDIKLTKDGNVL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CCT6A |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publication using NBP2-46715 | Applications | Species |
|---|---|---|
| Yagita Y, Zavodszky E, Peak-Chew SY, Hegde RS Mechanism of orphan subunit recognition during assembly quality control Cell 2023-07-19 [PMID: 37480851] (WB, Human) | WB | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for CCT6A Antibody (NBP2-46715)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: CCT6A Antibody [NBP2-46715] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/CCT6A-Antibody-Western-Blot-NBP2-46715-img0009.jpg "Western Blot: CCT6A Antibody [NBP2-46715] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Immunohistochemistry-Paraffin: CCT6A Antibody [NBP2-46715] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.](http://images.novusbio.com/fullsize/CCT6A-Antibody-Immunohistochemistry-Paraffin-NBP2-46715-img0006.jpg "Immunohistochemistry-Paraffin: CCT6A Antibody [NBP2-46715] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.")
![Western Blot: CCT6A Antibody [NBP2-46715] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10, Lane 2: Human cell line RT-4, Lane 3: Human cell line U-251 MG](http://images.novusbio.com/fullsize/CCT6A-Antibody-Western-Blot-NBP2-46715-img0003.jpg "Western Blot: CCT6A Antibody [NBP2-46715] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10, Lane 2: Human cell line RT-4, Lane 3: Human cell line U-251 MG")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")