NDUFA1 Antibody

Images

 
Immunohistochemistry-Paraffin: NDUFA1 Antibody [NBP2-49127] - Staining of human skin shows low expression as expected.
Immunohistochemistry: NDUFA1 Antibody [NBP2-49127] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: NDUFA1 Antibody [NBP2-49127] - Staining in human heart muscle and skin tissues using anti-NDUFA1 antibody. Corresponding NDUFA1 RNA-seq data are presented for the same tissues.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NDUFA1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: HRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRYYVSKG
Specificity
Specificity of human NDUFA1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NDUFA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NDUFA1 Recombinant Protein Antigen (NBP2-49127PEP)

Reactivity Notes

Mouse (82%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NDUFA1 Antibody

  • CI-MWFEcomplex I MWFE subunit
  • Complex I-MWFE
  • MWFENADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1
  • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1 (7.5kD, MWFE)
  • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1, 7.5kDa
  • NADH oxidoreductase subunit MWFE
  • NADH:ubiquinone oxidoreductase (complex 1)
  • NADH-ubiquinone oxidoreductase MWFE subunit
  • type I dehydrogenase
  • ZNF183

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83956
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89026
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-88938
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46173
Species: Hu
Applications: WB
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NB100-56511
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NB100-74340
Species: Hu, Mu, Rt, Bv, ChHa, Dr, Fu, Pl, Pr, Rb, Sh, Xp, Ye, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-88937
Species: Hu
Applications: IHC, IHC-P
NBP2-24567
Species: Hu
Applications: WB
NBP1-87308
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-32318
Species: Hu
Applications: WB, ICC/IF, IHC
NBP1-88934
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-32304
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP
H00004535-Q01
Species: Hu
NBP1-83766
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49127
Species: Hu
Applications: IHC, IHC-P

Publications for NDUFA1 Antibody (NBP2-49127) (0)

There are no publications for NDUFA1 Antibody (NBP2-49127).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDUFA1 Antibody (NBP2-49127) (0)

There are no reviews for NDUFA1 Antibody (NBP2-49127). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NDUFA1 Antibody (NBP2-49127) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for NDUFA1 Antibody (NBP2-49127)

Discover related pathways, diseases and genes to NDUFA1 Antibody (NBP2-49127). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDUFA1 Antibody (NBP2-49127)

Discover more about diseases related to NDUFA1 Antibody (NBP2-49127).
 

Pathways for NDUFA1 Antibody (NBP2-49127)

View related products by pathway.

PTMs for NDUFA1 Antibody (NBP2-49127)

Learn more about PTMs related to NDUFA1 Antibody (NBP2-49127).

Blogs on NDUFA1

There are no specific blogs for NDUFA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NDUFA1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NDUFA1