NDUFA1 Antibody


Immunohistochemistry-Paraffin: NDUFA1 Antibody [NBP2-49127] - Staining of human skin shows low expression as expected.
Immunohistochemistry: NDUFA1 Antibody [NBP2-49127] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.
Orthogonal Strategies: Immunohistochemistry-Paraffin: NDUFA1 Antibody [NBP2-49127] - Staining in human heart muscle and skin tissues using anti-NDUFA1 antibody. Corresponding NDUFA1 RNA-seq data are presented for ...read more

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

NDUFA1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: HRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRYYVSKG
Specificity of human NDUFA1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NDUFA1 Recombinant Protein Antigen (NBP2-49127PEP)

Reactivity Notes

Mouse (82%), Rat (82%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for NDUFA1 Antibody

  • CI-MWFEcomplex I MWFE subunit
  • Complex I-MWFE
  • MWFENADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1
  • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1 (7.5kD, MWFE)
  • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1, 7.5kDa
  • NADH oxidoreductase subunit MWFE
  • NADH:ubiquinone oxidoreductase (complex 1)
  • NADH-ubiquinone oxidoreductase MWFE subunit
  • type I dehydrogenase
  • ZNF183


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
Species: Hu, Mu, Rt, Dr, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, Flow-IC
Species: Hu, Mu, Rt, Bv, ChHa, Dr, Fu, Pl, Pr, Rb, Sh, Xp, Ye, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP, KO
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NDUFA1 Antibody (NBP2-49127) (0)

There are no publications for NDUFA1 Antibody (NBP2-49127).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDUFA1 Antibody (NBP2-49127) (0)

There are no reviews for NDUFA1 Antibody (NBP2-49127). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NDUFA1 Antibody (NBP2-49127) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for NDUFA1 Antibody (NBP2-49127)

Discover related pathways, diseases and genes to NDUFA1 Antibody (NBP2-49127). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDUFA1 Antibody (NBP2-49127)

Discover more about diseases related to NDUFA1 Antibody (NBP2-49127).

Pathways for NDUFA1 Antibody (NBP2-49127)

View related products by pathway.

PTMs for NDUFA1 Antibody (NBP2-49127)

Learn more about PTMs related to NDUFA1 Antibody (NBP2-49127).

Blogs on NDUFA1

There are no specific blogs for NDUFA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NDUFA1 Antibody and receive a gift card or discount.


Gene Symbol NDUFA1