DHX16 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: DHX16 Antibody [NBP2-13920] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: DHX16 Antibody [NBP2-13920] - Staining of human kidney shows strong nuclear positivity in renal tubules and glomeruli.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DHX16 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: HMPKETRGQPARAVDLVEEESGAPGEEQRRWEEARLGAASLKFGARDAAS QEPKYQLVLEEEETIEFVRATQLQGD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DHX16
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
DHX16 Protein (NBP2-13920PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DHX16 Antibody

  • ATP-dependent RNA helicase #3
  • DBP2PRO2014
  • DDX16DEAD/H box 16
  • DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 16
  • DEAH (Asp-Glu-Ala-His) box polypeptide 16
  • DEAH-box protein 16
  • EC 3.6.1
  • EC 3.6.4.13
  • KIAA0577
  • Prp2
  • PRP8
  • PRPF2
  • putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16
  • RNA helicase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85269
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22273
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB100-1713
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB100-56605
Species: Av, Bv, Sh
Applications: WB
NBP1-90086
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58541
Species: Hu
Applications: ICC/IF
NBP1-83219
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88263
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00079092-T01
Species: Hu
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-92692
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NB100-586
Species: Hu
Applications: WB, IP
NBP1-31354
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20403
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF5745
Species: Hu
Applications: WB, IHC
AF6387
Species: Hu
Applications: WB
NBP1-87019
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82510
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13920
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P

Publications for DHX16 Antibody (NBP2-13920) (0)

There are no publications for DHX16 Antibody (NBP2-13920).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DHX16 Antibody (NBP2-13920) (0)

There are no reviews for DHX16 Antibody (NBP2-13920). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DHX16 Antibody (NBP2-13920) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DHX16 Products

Bioinformatics Tool for DHX16 Antibody (NBP2-13920)

Discover related pathways, diseases and genes to DHX16 Antibody (NBP2-13920). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for DHX16 Antibody (NBP2-13920)

View related products by pathway.

Research Areas for DHX16 Antibody (NBP2-13920)

Find related products by research area.

Blogs on DHX16

There are no specific blogs for DHX16, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DHX16 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DHX16