RILP Antibody - BSA Free

Western Blot: RILP Antibody [NBP1-98278] - Human placenta Lysate 1.0ug/ml, Gel Concentration: 12%

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

RILP Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: The immunogen for this antibody is RILP antibody - C-terminal region. Peptide sequence PPPPESKIQSFFGLWYRGKAESSEDETSSPAPSKLGGEEEAQPQSPAPDP. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RILP
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 44 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for RILP Antibody - BSA Free

• rab-interacting lysosomal protein
• PP10141
• Rab interacting lysosomal protein

Background

This gene encodes a lysosomal protein that interacts with RAB7, a small GTPase that controls transport to endocytic degradative compartments. Studies using mutant forms of the two proteins suggest that this protein represents a downstream effector for RAB7, and both proteins act together in the regulation of late endocytic traffic. A unique region of this protein has also been shown to be involved in the regulation of lysosomal morphology.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RILP Antibody (NBP1-98278)(2)

Publications using NBP1-98278

• Deffieu M, Cesonyte I, Delalande F, et al. Rab7-harboring vesicles are carriers of the transferrin receptor through the biosynthetic secretory pathway Science Advances 2021-01-01 [PMID: 33523982]
• Munoz-Braceras S, Tornero-Ecija AR, Vincent O, Escalante R. VPS13A is closely associated with mitochondria and is required for efficient lysosomal degradation Dis Model Mech 2019-02-22 [PMID: 30709847] (WB, Human)

Bioinformatics

• Gene Symbol: RILP
• Uniprot:
  • NP_113618(Human)