IKBKAP Antibody (6G9)

Images

 
Western Blot: IKBKAP Antibody (6G9) [H00008518-M03] - Analysis of IKBKAP expression in HeLa (Cat # L013V1).
Immunohistochemistry-Paraffin: IKBKAP Antibody (6G9) [H00008518-M03] - Analysis of monoclonal antibody to IKBKAP on formalin-fixed paraffin-embedded human colon. Antibody concentration 3 ug/ml
ELISA: IKBKAP Antibody (6G9) [H00008518-M03] - Detection limit for recombinant GST tagged IKBKAP is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
6G9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

IKBKAP Antibody (6G9) Summary

Immunogen
IKBKAP (NP_003631 1242 a.a. - 1331 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VLFLFEFDEQGRELQKAFEDTLQLMERSLPEIWTLTYQQNSATPVLGPNSTANSIMASYQQQKTSVPVLDAELFIPPKINRRTQWKLSLL
Specificity
IKBKAP - inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase complex-associated protein
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
IKBKAP
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA.
Publications
Read Publication using H00008518-M03.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IKBKAP Antibody (6G9)

  • DYS
  • elongator complex protein 1
  • ELP1DKFZp781H1425
  • FD
  • FLJ12497
  • IKAPdysautonomia (Riley-Day syndrome, hereditary sensory autonomic neuropathy typeIII)
  • IkappaB kinase complex-associated protein
  • IKI3
  • IKK complex-associated protein
  • inhibitor of kappa light polypeptide gene enhancer in B-cells, kinasecomplex-associated protein
  • p150
  • TOT1

Background

The protein encoded by this gene is a scaffold protein and a regulator for 3 different kinases involved in proinflammatory signaling. This encoded protein can bind NF-kappa-B-inducing kinase (NIK) and IKKs through separate domains and assemble them into an active kinase complex. Mutations in this gene have been associated with familial dysautonomia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-610
Species: Hu, Ca, GP
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP
NB500-328
Species: Hu
Applications: Flow, IP, CyTOF-ready
NB110-89474
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF1008
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NB110-97871
Species: Mu
Applications: Flow, IHC, IHC-P, IP, CyTOF-ready
796-IC
Species: Mu
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
H00008518-M03
Species: Hu
Applications: WB, ELISA, IHC-P

Publications for IKBKAP Antibody (H00008518-M03)(1)

Reviews for IKBKAP Antibody (H00008518-M03) (0)

There are no reviews for IKBKAP Antibody (H00008518-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IKBKAP Antibody (H00008518-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IKBKAP Products

Bioinformatics Tool for IKBKAP Antibody (H00008518-M03)

Discover related pathways, diseases and genes to IKBKAP Antibody (H00008518-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IKBKAP Antibody (H00008518-M03)

Discover more about diseases related to IKBKAP Antibody (H00008518-M03).
 

Pathways for IKBKAP Antibody (H00008518-M03)

View related products by pathway.

PTMs for IKBKAP Antibody (H00008518-M03)

Learn more about PTMs related to IKBKAP Antibody (H00008518-M03).
 

Research Areas for IKBKAP Antibody (H00008518-M03)

Find related products by research area.

Blogs on IKBKAP

There are no specific blogs for IKBKAP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IKBKAP Antibody (6G9) and receive a gift card or discount.

Bioinformatics

Gene Symbol IKBKAP
Entrez
OMIM
Uniprot