IKBKAP Antibody (6G9)

Western Blot: IKBKAP Antibody (6G9) [H00008518-M03] - Analysis of IKBKAP expression in HeLa (Cat # L013V1).

Immunohistochemistry-Paraffin: IKBKAP Antibody (6G9) [H00008518-M03] - Analysis of monoclonal antibody to IKBKAP on formalin-fixed paraffin-embedded human colon. Antibody concentration 3 ug/ml

ELISA: IKBKAP Antibody (6G9) [H00008518-M03] - Detection limit for recombinant GST tagged IKBKAP is approximately 0.3ng/ml as a capture antibody.

• Reactivity: Hu, Mu
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 6G9
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

IKBKAP Antibody (6G9) Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: IKBKAP (NP_003631, 1242 a.a. ~ 1331 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VLFLFEFDEQGRELQKAFEDTLQLMERSLPEIWTLTYQQNSATPVLGPNSTANSIMASYQQQKTSVPVLDAELFIPPKINRRTQWKLSLL
• Specificity: IKBKAP - inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase complex-associated protein
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: ELP1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IKBKAP Antibody (6G9)

• DYS
• elongator complex protein 1
• ELP1DKFZp781H1425
• FD
• FLJ12497
• IKAPdysautonomia (Riley-Day syndrome, hereditary sensory autonomic neuropathy typeIII)
• IkappaB kinase complex-associated protein
• IKI3
• IKK complex-associated protein
• inhibitor of kappa light polypeptide gene enhancer in B-cells, kinasecomplex-associated protein
• p150
• TOT1

Background

The protein encoded by this gene is a scaffold protein and a regulator for 3 different kinases involved in proinflammatory signaling. This encoded protein can bind NF-kappa-B-inducing kinase (NIK) and IKKs through separate domains and assemble them into an active kinase complex. Mutations in this gene have been associated with familial dysautonomia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for IKBKAP Antibody (H00008518-M03)(2)

Publications using H00008518-M03

• Sinha R, Kim YJ, Nomakuchi T et al. Antisense oligonucleotides correct the familial dysautonomia splicing defect in IKBKAP transgenic mice. Nucleic Acids Res 2018-04-17 [PMID: 29672717]
• Lefler S, Cohen MA, Kantor G et al. Familial Dysautonomia (FD) Human Embryonic Stem Cell Derived PNS Neurons Reveal that Synaptic Vesicular and Neuronal Transport Genes Are Directly or Indirectly Affected by IKBKAP Downregulation. PLoS One. 2015-10-05 [PMID: 26437462]

Bioinformatics

• Gene Symbol: ELP1
• Entrez:
  • 8518(Human)
• OMIM:
  • 223900(Human)
• Uniprot:
  • NP_003631(Human)