Ribosomal Protein L17 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit Ribosomal Protein L17 Antibody - BSA Free (NBP2-48845) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: RAHGRINPYMSSPCHIEMILTEKEQIVPKPEEEVAQKKKISQKKLK |
| Predicted Species |
Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
RPL17 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Ribosomal Protein L17 Antibody - BSA Free
Background
Ribosomal Protein L17, also known as 60S ribosomal protein L23, is a 21kDa 184 amino acid protein with a shorter 17kDa 146 isoform and a longer 26kDa 228 isoform produced by alternative splicing. Ribosomal Protein L17 belongs to the L22P family of ribosomal proteins and can be found in the cytoplasm. Current research is being conducted on Ribosomal Protein L17 and its relationship to Treacher Collins syndrome, gastric cancer, pancreatitis and malaria. Ribosomal Protein L17 has been linked to the ribosome assembly, protein folding, cell proliferation and cell growth pathways where it interacts with RPL4, RPL11, RPL26, RPL27A and RPL35.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, WB
Species: Hu
Applications: Block, CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, Neut
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu
Applications: AgAct, ICC, WB
Species: Hu
Applications: IHC, WB
Species: Mu
Applications: BA
Species: Hu
Applications: BA
Species: Bv, Hu, Mu, Rt
Applications: Dual ISH-IHC, Flow, IB, ICC/IF, IHC, IHC-P, IP, Single-Cell Western, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, KO, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Publications for Ribosomal Protein L17 Antibody (NBP2-48845) (0)
There are no publications for Ribosomal Protein L17 Antibody (NBP2-48845).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Ribosomal Protein L17 Antibody (NBP2-48845) (0)
There are no reviews for Ribosomal Protein L17 Antibody (NBP2-48845).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Ribosomal Protein L17 Antibody (NBP2-48845) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Ribosomal Protein L17 Products
Research Areas for Ribosomal Protein L17 Antibody (NBP2-48845)
Find related products by research area.
|
Blogs on Ribosomal Protein L17