RHBDF1 Antibody (NBP1-59725)

Images

 
Western Blot: RHBDF1 Antibody [NBP1-59725] - Sample Tissue: 721_B Whole Cell, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, ...read more
Western Blot: RHBDF1 Antibody [NBP1-59725] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RHBDF1 Antibody Summary

Immunogen
Synthetic peptides corresponding to RHBDF1(rhomboid 5 homolog 1 (Drosophila)) The peptide sequence was selected from the N terminal of RHBDF1. Peptide sequence KDWEKAPEQADLTGGALDRSELERSHLMLPLERGWRKQKEGAAAPQPKVR.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RHBDF1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against RHBDF1 and was validated on Western blot.
Theoretical MW
97 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RHBDF1 Antibody

  • C16orf8
  • chromosome 16 open reading frame 8
  • Dist1
  • EGFR-RS
  • epidermal growth factor receptor, related sequence
  • FLJ2235
  • FLJ22357
  • gene-89
  • gene-90
  • hDist1
  • p100hRho
  • rhomboid 5 homolog 1 (Drosophila)
  • Rhomboid 5 homolog 1
  • rhomboid family 1 (Drosophila)
  • rhomboid family 1
  • rhomboid family member 1

Background

RHBDF1 is a seven-transmembrane protein with a long N-terminal cytoplasmic extension that comprises half of the polypeptide sequence, and is found in the endoplasmic reticulum and Golgi, but not on the cell surface. RHBDF1 has a pivotal role in sustaining growth signals in epithelial cancer cells and thus may serve as a therapeutic target for treating epithelial cancers.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1095
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICC, ICFlow
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-41083
Species: Hu
Applications: WB, ChIP, ELISA
NBP1-82787
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF2727
Species: Hu
Applications: WB, Simple Western, ICC
NB100-74648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-83013
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24695
Species: Hu
Applications: WB, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
MAB3481
Species: Hu
Applications: Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-26612
Species: Hu
Applications: IP (-), WB
NBP1-59725
Species: Hu
Applications: WB

Publications for RHBDF1 Antibody (NBP1-59725) (0)

There are no publications for RHBDF1 Antibody (NBP1-59725).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RHBDF1 Antibody (NBP1-59725) (0)

There are no reviews for RHBDF1 Antibody (NBP1-59725). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RHBDF1 Antibody (NBP1-59725) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RHBDF1 Products

Related Products by Gene

Bioinformatics Tool for RHBDF1 Antibody (NBP1-59725)

Discover related pathways, diseases and genes to RHBDF1 Antibody (NBP1-59725). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RHBDF1 Antibody (NBP1-59725)

Discover more about diseases related to RHBDF1 Antibody (NBP1-59725).
 

Pathways for RHBDF1 Antibody (NBP1-59725)

View related products by pathway.

PTMs for RHBDF1 Antibody (NBP1-59725)

Learn more about PTMs related to RHBDF1 Antibody (NBP1-59725).

Blogs on RHBDF1

There are no specific blogs for RHBDF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RHBDF1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RHBDF1
Uniprot