RHBDF1 Antibody


Western Blot: RHBDF1 Antibody [NBP1-59725] - Sample Tissue: 721_B Whole Cell, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, ...read more
Western Blot: RHBDF1 Antibody [NBP1-59725] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

RHBDF1 Antibody Summary

Synthetic peptides corresponding to RHBDF1(rhomboid 5 homolog 1 (Drosophila)) The peptide sequence was selected from the N terminal of RHBDF1. Peptide sequence KDWEKAPEQADLTGGALDRSELERSHLMLPLERGWRKQKEGAAAPQPKVR.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against RHBDF1 and was validated on Western blot.

The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Theoretical MW
97 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RHBDF1 Antibody

  • C16orf8
  • chromosome 16 open reading frame 8
  • Dist1
  • epidermal growth factor receptor, related sequence
  • FLJ2235
  • FLJ22357
  • gene-89
  • gene-90
  • hDist1
  • p100hRho
  • rhomboid 5 homolog 1 (Drosophila)
  • Rhomboid 5 homolog 1
  • rhomboid family 1 (Drosophila)
  • rhomboid family 1
  • rhomboid family member 1


RHBDF1 is a seven-transmembrane protein with a long N-terminal cytoplasmic extension that comprises half of the polypeptide sequence, and is found in the endoplasmic reticulum and Golgi, but not on the cell surface. RHBDF1 has a pivotal role in sustaining growth signals in epithelial cancer cells and thus may serve as a therapeutic target for treating epithelial cancers.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICC, ICFlow
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ChIP, ELISA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC-P
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
Species: Hu
Applications: WB, Flow, CyTOF-ready, Neut
Species: Hu
Applications: IP (-), WB
Species: Hu
Applications: WB

Publications for RHBDF1 Antibody (NBP1-59725) (0)

There are no publications for RHBDF1 Antibody (NBP1-59725).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RHBDF1 Antibody (NBP1-59725) (0)

There are no reviews for RHBDF1 Antibody (NBP1-59725). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RHBDF1 Antibody (NBP1-59725) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional RHBDF1 Antibody Products

Related Products by Gene

Bioinformatics Tool for RHBDF1 Antibody (NBP1-59725)

Discover related pathways, diseases and genes to RHBDF1 Antibody (NBP1-59725). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RHBDF1 Antibody (NBP1-59725)

Discover more about diseases related to RHBDF1 Antibody (NBP1-59725).

Pathways for RHBDF1 Antibody (NBP1-59725)

View related products by pathway.

PTMs for RHBDF1 Antibody (NBP1-59725)

Learn more about PTMs related to RHBDF1 Antibody (NBP1-59725).

Blogs on RHBDF1

There are no specific blogs for RHBDF1, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RHBDF1 Antibody and receive a gift card or discount.


Gene Symbol RHBDF1

Customers Who Bought This Also Bought