RHBDF1 Antibody - BSA Free

Western Blot: RHBDF1 Antibody [NBP1-59725] - Sample Tissue: 721_B Whole Cell, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, Lysate Quantity: 25ug/lane/Lane, Gel Concentration: 0.

Western Blot: RHBDF1 Antibody [NBP1-59725] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

RHBDF1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to RHBDF1(rhomboid 5 homolog 1 (Drosophila)) The peptide sequence was selected from the N terminal of RHBDF1. Peptide sequence KDWEKAPEQADLTGGALDRSELERSHLMLPLERGWRKQKEGAAAPQPKVR. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RHBDF1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 97 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for RHBDF1 Antibody - BSA Free

• C16orf8
• chromosome 16 open reading frame 8
• Dist1
• EGFR-RS
• epidermal growth factor receptor, related sequence
• FLJ2235
• FLJ22357
• gene-89
• gene-90
• hDist1
• p100hRho
• rhomboid 5 homolog 1 (Drosophila)
• Rhomboid 5 homolog 1
• rhomboid family 1 (Drosophila)
• rhomboid family 1
• rhomboid family member 1

Background

RHBDF1 is a seven-transmembrane protein with a long N-terminal cytoplasmic extension that comprises half of the polypeptide sequence, and is found in the endoplasmic reticulum and Golgi, but not on the cell surface. RHBDF1 has a pivotal role in sustaining growth signals in epithelial cancer cells and thus may serve as a therapeutic target for treating epithelial cancers.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RHBDF1
• Uniprot:
  • Q96CC6(Human)