PLEKHM1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PLEKHM1 Antibody [NBP2-38449] - Staining of human cell line U-2 OS shows localization to nucleoli & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PLEKHM1 Antibody [NBP2-38449] - Staining of human small intestine shows moderate cytoplasmic postivity in glandular cells.
Immunohistochemistry-Paraffin: PLEKHM1 Antibody [NBP2-38449] - Staining of human cerebral cortex shows moderate postivity in neuropil.
Immunohistochemistry-Paraffin: PLEKHM1 Antibody [NBP2-38449] - Staining of human fallopian tube shows moderate cytoplasmic postivity in glandular cells.
Immunohistochemistry-Paraffin: PLEKHM1 Antibody [NBP2-38449] - Staining of human placenta shows moderate granular cytoplasmic postivity in trophoblastic cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PLEKHM1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PARIIHNWDLTKRPICRQALKFLTQIRAQPLINLQMVNASLYEHVERMHLIGR
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PLEKHM1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PLEKHM1 Protein (NBP2-38449PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PLEKHM1 Antibody

  • 162 kDa adapter protein
  • AP162
  • hsa-mir-4315-1
  • KIAA0356
  • microRNA 4315-1
  • PH domain-containing family M member 1

Background

PLEKHM1 - pleckstrin homology domain containing, family M (with RUN domain) member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PLEKHM1 Antibody (NBP2-38449) (0)

There are no publications for PLEKHM1 Antibody (NBP2-38449).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLEKHM1 Antibody (NBP2-38449) (0)

There are no reviews for PLEKHM1 Antibody (NBP2-38449). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PLEKHM1 Antibody (NBP2-38449) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PLEKHM1 Products

Research Areas for PLEKHM1 Antibody (NBP2-38449)

Find related products by research area.

Blogs on PLEKHM1

There are no specific blogs for PLEKHM1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PLEKHM1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PLEKHM1
Uniprot