OAS3 Antibody

Images

 
Western Blot: OAS3 Antibody [NBP1-85841] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: OAS3 Antibody [NBP1-85841] - Staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: OAS3 Antibody [NBP1-85841] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: OAS3 Antibody [NBP1-85841] - Staining of human urinary bladder shows moderate cytoplasmic positivity in urothelial cells.
Immunohistochemistry-Paraffin: OAS3 Antibody [NBP1-85841] - Staining of human duodenum shows weak cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: OAS3 Antibody [NBP1-85841] - Staining of human liver shows no positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

OAS3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TWDLGNGAAWHWDLLAQEAASCYDHPCFLRGMGDPVQSWKGPGLPRAGCSGLGHPIQLDPNQKTPENSKSLNAVYPRAGSKPPSCP
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OAS3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
OAS3 Protein (NBP1-85841PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for OAS3 Antibody

  • (2-5')oligo(A) synthase 3,2'-5'oligoadenylate synthetase p100
  • 2-5A synthase 3
  • 2'-5'-oligoadenylate synthase 3
  • 2'-5'-oligoadenylate synthetase 3, 100kDa
  • P/OKcl.4
  • p100 OAS

Background

The OAS3 gene encodes an enzyme included in the 2', 5' oligoadenylate synthase family. This enzyme is induced by interferons and catalyzes the 2', 5' oligomers of adenosine in order to bind and activate RNase L. This enzyme family plays a significant role in

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for OAS3 Antibody (NBP1-85841) (0)

There are no publications for OAS3 Antibody (NBP1-85841).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OAS3 Antibody (NBP1-85841) (0)

There are no reviews for OAS3 Antibody (NBP1-85841). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for OAS3 Antibody (NBP1-85841) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional OAS3 Products

Research Areas for OAS3 Antibody (NBP1-85841)

Find related products by research area.

Blogs on OAS3

There are no specific blogs for OAS3, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OAS3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OAS3