RFX1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: RFX1 Antibody [NBP3-17759] - Staining of human cell line PC-3 shows localization to nucleoplasm.

ChIP-Exo-Seq composite graph for Anti-RFX1 (NBP3-17759) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RFX1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RFX1 Antibody - BSA Free (NBP3-17759) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DASYTASAIRSSTYSYPETPLYTQTASTSYYEAAGTATQVSTPATSQAVASSGSMPMYVSGSQV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RFX1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence, PFA/Triton X-100 is recommended for fixation/permeabilization.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RFX1 Antibody - BSA Free

• EFC
• EF-C
• Enhancer factor C
• MHC class II regulatory factor RFX
• MHC class II regulatory factor RFX1
• Regulatory factor X 1
• regulatory factor X, 1 (influences HLA class II expression)
• RFX
• trans-acting regulatory factor 1
• Transcription factor RFX1

Background

RFX1, also known as MHC class II regulatory factor RFX1, is a 105 kDa 979 amino acid protein found in the nucleus. The gene plays a significant role in the gene expression of MHC class II. Current research on RFX1 is being conducted in relation to hepatitis, leukemia, neuroblastoma , sickle cell anemia and adenocarcinoma. RFX1 has been linked to the methlation, immune response, spermatogenesis and localization pathways where it interacts with TADA3, SMAD1, HDAC1, ADD1 and SMAD9.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RFX1