RFX1 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: DASYTASAIRSSTYSYPETPLYTQTASTSYYEAAGTATQVSTPATSQAVASSGSMPMYVSGSQV |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
RFX1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
Immunocytochemistry/Immunofluorescence, PFA/Triton X-100 is recommended for fixation/permeabilization. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for RFX1 Antibody - BSA Free
Background
RFX1, also known as MHC class II regulatory factor RFX1, is a 105 kDa 979 amino acid protein found in the nucleus. The gene plays a significant role in the gene expression of MHC class II. Current research on RFX1 is being conducted in relation to hepatitis, leukemia, neuroblastoma , sickle cell anemia and adenocarcinoma. RFX1 has been linked to the methlation, immune response, spermatogenesis and localization pathways where it interacts with TADA3, SMAD1, HDAC1, ADD1 and SMAD9.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC, IHC-P, WB
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC, IHC-P, WB
Species: Pm, Ca, Hu, Pm
Applications: B/N, CyTOF-ready, Dual ISH-IHC, EM, ELISA, Flow-CS, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Bv, Ca, Hu, Mu, Rt
Applications: PEP-ELISA
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
Species: Mu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Rt
Applications: ICC/IF, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Mu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Publications for RFX1 Antibody (NBP3-17759) (0)
There are no publications for RFX1 Antibody (NBP3-17759).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for RFX1 Antibody (NBP3-17759) (0)
There are no reviews for RFX1 Antibody (NBP3-17759).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for RFX1 Antibody (NBP3-17759) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional RFX1 Products
Research Areas for RFX1 Antibody (NBP3-17759)
Find related products by research area.
|
Blogs on RFX1