FNBP1 Antibody

Images

 
Independent Antibodies: Western Blot: FNBP1 Antibody [NBP2-48542] - Analysis using Anti-FNBP1 antibody NBP2-48542 (A) shows similar pattern to independent antibody NBP2-48556 (B).
Immunohistochemistry-Paraffin: FNBP1 Antibody [NBP2-48542] - Staining of human testis.
Western Blot: FNBP1 Antibody [NBP2-48542] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: FNBP1 Antibody [NBP2-48542] - Staining of human appendix shows strong cytoplasmic positivity in lymphoid tissue.
Immunohistochemistry-Paraffin: FNBP1 Antibody [NBP2-48542] - Staining of human lymph node shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: FNBP1 Antibody [NBP2-48542] - Staining in human lymph node and skeletal muscle tissues using anti-FNBP1 antibody. Corresponding FNBP1 RNA-seq data are ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: FNBP1 Antibody [NBP2-48542] - Staining of human colon, lymph node, skeletal muscle and testis using Anti-FNBP1 antibody NBP2-48542 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: FNBP1 Antibody [NBP2-48542] - Staining of human colon.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FNBP1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: KARQQAQIRHQMAEDSKADYSSILQKFNHEQHEYYHTHIPNIFQKIQEMEERRIVRMGESMKTYAEVDRQVIPIIGKCLDGIVKAAESIDQKNDSQLVIEAYKSGFE
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FNBP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FNBP1 Recombinant Protein Antigen (NBP2-48542PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FNBP1 Antibody

  • FBP17KIAA0554Formin-binding protein 17
  • formin binding protein 1
  • formin-binding protein 1
  • hFBP17
  • MGC126804

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FNBP1 Antibody (NBP2-48542) (0)

There are no publications for FNBP1 Antibody (NBP2-48542).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FNBP1 Antibody (NBP2-48542) (0)

There are no reviews for FNBP1 Antibody (NBP2-48542). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FNBP1 Antibody (NBP2-48542) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FNBP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FNBP1