RFX3 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: RFX3 Antibody [NBP1-86301] - Staining in human testis and liver tissues using anti-RFX3 antibody. Corresponding RFX3 RNA-seq data are presented for the same ...read more
Western Blot: RFX3 Antibody [NBP1-86301] - Analysis in control (vector only transfected HEK293T lysate) and rFX3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: RFX3 Antibody [NBP1-86301] - Staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: RFX3 Antibody [NBP1-86301] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: RFX3 Antibody [NBP1-86301] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: RFX3 Antibody [NBP1-86301] -Staining of human fallopian tube shows moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: RFX3 Antibody [NBP1-86301] -Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: RFX3 Antibody [NBP1-86301] -Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

RFX3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QYMAMRQQPMQQKQRYKPMQKVDGVADGFTGSGQQTGTSVEQTVIAQSQHHQQFLDASRALPEFGEVEISSLPDGTTFEDIKSLQSLYREHCEAILDVVVNLQFSLIEKLWQTFWRYSPSTPTDGTTITESSNLSE
Predicted Species
Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RFX3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RFX3 Protein (NBP1-86301PEP)
Publications
Read Publications using
NBP1-86301 in the following applications:

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 25599390).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RFX3 Antibody

  • bA32F11.1
  • DNA binding protein RFX3
  • MGC87155
  • Regulatory factor X 3
  • regulatory factor X, 3 (influences HLA class II expression)
  • transcription factor RFX3

Background

RFX3 is a member of the regulatory factor X gene family, which encodes transcription factors that contain a highly-conserved winged helix DNA binding domain. The protein encoded by this gene is structurally related to regulatory factors X1, X2, X4, and X5. It is a transcriptional activator that can bind DNA as a monomer or as a heterodimer with other RFX family members. Two transcript variants encoding different isoforms have been described for this gene, and at least one of the variants utilizes alternative polyadenylation signals. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RFX3 Antibody (NBP1-86301)(2)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 2 applications: ICC/IF, IF/IHC.


Filter By Application
ICC/IF
(1)
IF/IHC
(1)
All Applications
Filter By Species
Mouse
(2)
All Species

Reviews for RFX3 Antibody (NBP1-86301) (0)

There are no reviews for RFX3 Antibody (NBP1-86301). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RFX3 Antibody (NBP1-86301) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RFX3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RFX3