RFX2 Antibody


Western Blot: RFX2 Antibody [NBP2-13224] - Analysis in human cell line SCLC-21H.
Immunocytochemistry/ Immunofluorescence: RFX2 Antibody [NBP2-13224] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm, cytosol & the Golgi apparatus.
Immunohistochemistry-Paraffin: RFX2 Antibody [NBP2-13224] - Staining in human testis and prostate tissues using anti-RFX2 antibody. Corresponding RFX2 RNA-seq data are presented for the same tissues.
Western Blot: RFX2 Antibody [NBP2-13224] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: RFX2 Antibody [NBP2-13224] - Staining of human prostate shows low expression as expected.
Immunohistochemistry-Paraffin: RFX2 Antibody [NBP2-13224] - Staining of human testis shows high expression.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

RFX2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: VMGEFNDLASLSLTLLDKDDMGDEQRGSEAGPDARSLGEPLVKRERSDPN HSLQGI
Specificity of human RFX2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RFX2 Protein (NBP2-13224PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%), Rat (80%).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for RFX2 Antibody

  • DNA binding protein RFX2
  • DNA-binding protein RFX2
  • FLJ14226
  • HLA class II regulatory factor RFX2
  • Regulatory factor X 2
  • regulatory factor X, 2 (influences HLA class II expression)
  • trans-acting regulatory factor 2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
Species: Hu, Po, Ca, Pm
Applications: WB, Simple Western
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RFX2 Antibody (NBP2-13224) (0)

There are no publications for RFX2 Antibody (NBP2-13224).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RFX2 Antibody (NBP2-13224) (0)

There are no reviews for RFX2 Antibody (NBP2-13224). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RFX2 Antibody (NBP2-13224) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional RFX2 Products

Bioinformatics Tool for RFX2 Antibody (NBP2-13224)

Discover related pathways, diseases and genes to RFX2 Antibody (NBP2-13224). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RFX2 Antibody (NBP2-13224)

Discover more about diseases related to RFX2 Antibody (NBP2-13224).

Pathways for RFX2 Antibody (NBP2-13224)

View related products by pathway.

PTMs for RFX2 Antibody (NBP2-13224)

Learn more about PTMs related to RFX2 Antibody (NBP2-13224).

Blogs on RFX2

There are no specific blogs for RFX2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RFX2 Antibody and receive a gift card or discount.


Gene Symbol RFX2