RFXAP Antibody - Azide and BSA Free

Western Blot: RFXAP Antibody [H00005994-D01P] - Analysis of RFXAP expression in human kidney.

Immunocytochemistry/Immunofluorescence: RFXAP Antibody [H00005994-D01P] - Analysis of antibody to RFXAP on HeLa cell. Antibody concentration 20 ug/ml.

Western Blot: RFXAP Antibody [H00005994-D01P] - Analysis of RFXAP expression in transfected 293T cell line by RFXAP polyclonal antibody.Lane 1: RFXAP transfected lysate(28.30 KDa).Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

RFXAP Antibody - Azide and BSA Free Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: RFXAP (AAH26088.1, 1 a.a. - 272 a.a.) full-length human protein. MEAQSVAEGAGPGAASGVPHPAALAPAAAPTLAPASVAAAASQFTLLVMQPCAGQDEAAAPGGSVGAGKPVRYLCEGAGDGEEEAGEDEADLLDTSDPPGGGESAASLEDLEDEETHSGGEGSSGGARRRGSGGGSMSKTCTYEGCSETTSQVAKQRKPWMCKKHRNKMYKDKYKKKKSDQALNCGGTASTGSAGNVKLEESADNILSIVKQRTGSFGDRPARPTLLEQVLNQKRLSLLRSPEVVQFLQKQQQLLNQQVLEQRQQQFPGTSM
• Specificity: Reacts with regulatory factor X-associated protein.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RFXAP
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: This antibody is reactive against tissue and transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RFXAP Antibody - Azide and BSA Free

• regulatory factor X-associated protein
• RFX DNA-binding complex 36 kDa subunit
• RFX-associated protein

Background

Major histocompatibility (MHC) class II molecules are transmembrane proteins that have a central role in development and control of the immune system. The protein encoded by this gene, along with regulatory factor X-associated ankyrin-containing protein and regulatory factor-5, forms a complex that binds to the X box motif of certain MHC class II gene promoters and activates their transcription. Once bound to the promoter, this complex associates with the non-DNA-binding factor MHC class II transactivator, which controls the cell type specificity and inducibility of MHC class II gene expression. Mutations in this gene have been linked to bare lymphocyte syndrome type II, complementation group D. Transcript variants utilizing different polyA signals have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RFXAP
• Entrez:
  • 5994(Human)
• Uniprot:
  • AAH26088.1(Human)