RENBP Antibody

Images

 
Immunohistochemistry-Paraffin: RENBP Antibody [NBP1-80852] - Staining of human spleen shows high expression.
Immunohistochemistry-Paraffin: RENBP Antibody [NBP1-80852] - Staining of human kidney shows strong nuclear and cytoplasmic positivity in tubule cells.
Immunohistochemistry-Paraffin: RENBP Antibody [NBP1-80852] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: RENBP Antibody [NBP1-80852] - Staining in human spleen and liver tissues using anti-RENBP antibody. Corresponding RENBP RNA-seq data are presented for the same tissues.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RENBP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DMEKERETLQAWKERVGQELDRVVAFWMEHSHDQEHGGFFTCLGREGRVYDDLKYVWLQGRQVWMYCRLYRTFERFRHAQLLDAAKAGGEFLLRYARVAPPGKKCAFVLTRDGRPVKVQRTIFSE
Specificity
Specificity of human RENBP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RENBP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RENBP Protein (NBP1-80852PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RENBP Antibody

  • AGE
  • EC 5.1.3.8
  • GlcNAc 2-epimerase
  • N-acetyl-D-glucosamine 2-epimerase
  • N-acylglucosamine 2-epimerase
  • RBP
  • renin binding protein
  • Renin-binding protein
  • RNBP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-03950
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-52575
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
AF5129
Species: Hu
Applications: WB
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NB100-56583
Species: Hu
Applications: WB, Flow, IHC-P
NB100-62346
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-92164
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-31555
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NB100-81029
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80852
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for RENBP Antibody (NBP1-80852) (0)

There are no publications for RENBP Antibody (NBP1-80852).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RENBP Antibody (NBP1-80852) (0)

There are no reviews for RENBP Antibody (NBP1-80852). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RENBP Antibody (NBP1-80852) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for RENBP Antibody (NBP1-80852)

Discover related pathways, diseases and genes to RENBP Antibody (NBP1-80852). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RENBP Antibody (NBP1-80852)

Discover more about diseases related to RENBP Antibody (NBP1-80852).
 

Pathways for RENBP Antibody (NBP1-80852)

View related products by pathway.

PTMs for RENBP Antibody (NBP1-80852)

Learn more about PTMs related to RENBP Antibody (NBP1-80852).

Blogs on RENBP

There are no specific blogs for RENBP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RENBP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RENBP