NAG Antibody - BSA Free

Western Blot: NAG Antibody [NBP2-93277] - Analysis of extracts of various cell lines, using NAG .Exposure time: 90s.

Immunocytochemistry/Immunofluorescence: NAG Antibody [NBP2-93277] - Immunofluorescence analysis of H9C2 cells using NAG Rabbit pAb (NBP2-93277) at dilution of 1:100. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NAG Antibody - BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human NBAS (NP_056993.2). MAAPESGPALSPGTAEGEEETILYDLLVNTEWPPETEVQPRGNQKHGASFIITKAIRDRLLFLRQYIWYS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NBAS
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 1:50 - 1:200
  • Western Blot 1:200-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for NAG Antibody - BSA Free

• DKFZp586G1219
• EC 1.1.1.94
• EC 1.2.1.59
• FLJ40407
• NAG/BC035112 fusion
• NAG/FAM49A fusion
• NAGneuroblastoma-amplified protein
• neuroblastoma amplified sequence
• Neuroblastoma-amplified gene protein
• neuroblastoma-amplified sequence

Background

NAG (Neuroblastoma-amplified gene protein) is a 2371 amino acid thought to be involved in Golgi-to-ER transport. It is broadly expressed and it may have involvement in short stature, optic nerve atrophy, and Pelger-Huet anomaly.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NBAS