REM1 Antibody - BSA Free Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to the amino acids: QEAKTPLHRRASTPLPLSPRGHQPGRLSTVPSTQSQHPRLGQSASLNPPTQKPSPAPDDWSSESSDSEGSWEALYRVVLLGD |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
REM1 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (87%)
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for REM1 Antibody - BSA Free
Background
The Ras-encoded family of proteins bind GDP and GTP with high affinity. They possess a low level of intrinsic GTPase activity that increases more than 100-fold when interacting with cytosolic GTPase activating protein (GAP). Ras family members include H-Ras, K-Ras, N-Ras, M-Ras, R-Ras, ERas, Rheb, TC 21, RASL11B and Rad (Ras associated with diabetes) GTPase.Rad GTPase is a GTP-binding protein that is similar to Ras but has unique features. Unlike other small GTPases, Rad GTPase lacks typical pren-ylation motifs at its C terminus. The Rad GTPase enzyme binds calmodulin, inhibits vascular lesion formation, has low intrinsic GTPase activity and cannot be stimulated by any known GAP molecules. Rad GTPase is expressed in skeletal muscle, cardiac muscle and lung tissues and is overexpressed in the skeletal muscle tissue of individuals with type II diabetes.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: Neut, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu
Applications: IHC
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: KO, PEP-ELISA, WB
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC
Publications for REM1 Antibody (NBP2-13217) (0)
There are no publications for REM1 Antibody (NBP2-13217).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for REM1 Antibody (NBP2-13217) (0)
There are no reviews for REM1 Antibody (NBP2-13217).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for REM1 Antibody (NBP2-13217) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional REM1 Products
Research Areas for REM1 Antibody (NBP2-13217)
Find related products by research area.
|
Blogs on REM1