REM1 Antibody

Images

 
Immunohistochemistry-Paraffin: REM1 Antibody [NBP2-13217] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

REM1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QEAKTPLHRRASTPLPLSPRGHQPGRLSTVPSTQSQHPRLGQSASLNPPT QKPSPAPDDWSSESSDSEGSWEALYRVVLLGD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
REM1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
REM1 Protein (NBP2-13217PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for REM1 Antibody

  • GESGD:REM
  • GTPase GES
  • GTPase-regulating endothelial cell sprouting
  • GTP-binding protein REM 1
  • MGC48669
  • Rad and Gem-like GTP-binding protein 1
  • RAS (RAD and GEM)-like GTP-binding 1
  • RAS (RAD and GEM)-like GTP-binding
  • REM

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010908-M08
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF-249-NA
Species: Hu
Applications: WB, Neut
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP1-58906
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
MAB763
Species: Hu, Mu, Rt
Applications: IHC
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13266
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00051053-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-47927
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13217
Species: Hu
Applications: IHC, IHC-P

Publications for REM1 Antibody (NBP2-13217) (0)

There are no publications for REM1 Antibody (NBP2-13217).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for REM1 Antibody (NBP2-13217) (0)

There are no reviews for REM1 Antibody (NBP2-13217). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for REM1 Antibody (NBP2-13217) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional REM1 Products

Bioinformatics Tool for REM1 Antibody (NBP2-13217)

Discover related pathways, diseases and genes to REM1 Antibody (NBP2-13217). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for REM1 Antibody (NBP2-13217)

Discover more about diseases related to REM1 Antibody (NBP2-13217).
 

Pathways for REM1 Antibody (NBP2-13217)

View related products by pathway.

PTMs for REM1 Antibody (NBP2-13217)

Learn more about PTMs related to REM1 Antibody (NBP2-13217).
 

Research Areas for REM1 Antibody (NBP2-13217)

Find related products by research area.

Blogs on REM1

There are no specific blogs for REM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our REM1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol REM1