Geminin Antibody (1A8)

Images

 
Western Blot: Geminin Antibody (1A8) [H00051053-M01] - Analysis of GMNN expression in transfected 293T cell line by GMNN monoclonal antibody (M01), clone 1A8.Lane 1: GMNN transfected lysate(23.6 KDa).Lane 2: ...read more
Immunocytochemistry/ Immunofluorescence: Geminin Antibody (1A8) [H00051053-M01] - Analysis of monoclonal antibody to GMNN on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: Geminin Antibody (1A8) [H00051053-M01] - Analysis of monoclonal antibody to GMNN on formalin-fixed paraffin-embedded human placenta. Antibody concentration 1 ug/ml.
Immunohistochemistry-Paraffin: Geminin Antibody (1A8) [H00051053-M01] - Analysis of monoclonal antibody to GMNN on formalin-fixed paraffin-embedded human lymph node. Antibody concentration 3 ug/ml.
ELISA: Geminin Antibody (1A8) [H00051053-M01] - Detection limit for recombinant GST tagged GMNN is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Clone
1A8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Geminin Antibody (1A8) Summary

Immunogen
GMNN (AAH05185, 110 a.a. ~ 209 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLVEDSEIGTCAEGTVSSSTDAKPCI
Specificity
GMNN - geminin, DNA replication inhibitor
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GMNN
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
Application Notes
Antibody reactive against recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA.
Publications
Read Publications using H00051053-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Geminin Antibody (1A8)

  • Gem
  • geminin
  • geminin, DNA replication inhibitor
  • RP3-369A17.3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2567
Species: Hu
Applications: WB, IHC, IHC-P, IP
H00004176-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, PLA, S-ELISA
NBP2-13266
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-15837
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC, IHC-P
MAB12251
Species: Hu
Applications: Flow, CyTOF-ready
NB100-288
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00005241-M08
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP3-05061
Species: Hu, Mu
Applications: WB, ICC/IF
NB200-103
Species: Hu, Mu, Rt, Ch, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-66987
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00028954-B01P
Species: Hu
Applications: WB, ICC/IF
NBP2-76833
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-58906
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00051053-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA

Publications for Geminin Antibody (H00051053-M01)(3)


Showing Publications 1 - 3 of 3.
Publications using H00051053-M01 Applications Species
Wang Y, Bernhardy AJ, Cruz C et al. The BRCA1-?11q Alternative Splice Isoform Bypasses Germline Mutations and Promotes Therapeutic Resistance to PARP Inhibition and Cisplatin Cancer Res May 15 2016
Nacson J, Krais JJ, Bernhardy AJ et al. BRCA1 Mutation-Specific Responses to 53BP1 Loss-Induced Homologous Recombination and PARP Inhibitor Resistance. Cell Rep Sep 25 2018 [PMID: 30257212]
Wang Y, Bernhardy AJ, Cruz C et al. The BRCA1-delta11q Alternative Splice Isoform Bypasses Germline Mutations and Promotes Therapeutic Resistance to PARP Inhibition and Cisplatin Cancer Res 2016 May 15 [PMID: 27197267]

Reviews for Geminin Antibody (H00051053-M01) (0)

There are no reviews for Geminin Antibody (H00051053-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Geminin Antibody (H00051053-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Geminin Products

Bioinformatics Tool for Geminin Antibody (H00051053-M01)

Discover related pathways, diseases and genes to Geminin Antibody (H00051053-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Geminin Antibody (H00051053-M01)

Discover more about diseases related to Geminin Antibody (H00051053-M01).
 

Pathways for Geminin Antibody (H00051053-M01)

View related products by pathway.

PTMs for Geminin Antibody (H00051053-M01)

Learn more about PTMs related to Geminin Antibody (H00051053-M01).
 

Research Areas for Geminin Antibody (H00051053-M01)

Find related products by research area.

Blogs on Geminin

There are no specific blogs for Geminin, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Geminin Antibody (1A8) and receive a gift card or discount.

Bioinformatics

Gene Symbol GMNN
Entrez
OMIM
Uniprot