REM1 Antibody


Western Blot: REM1 Antibody [NBP1-55506] - Hela cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

REM1 Antibody Summary

Synthetic peptides corresponding to REM1(RAS (RAD and GEM)-like GTP-binding 1) Antibody(against the N terminal of REM1. Peptide sequence SDSEGSWEALYRVVLLGDPGVGKTSLASLFAGKQERDLHEQLGEDVYERT.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against REM1 and was validated on Western blot.
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for REM1 Antibody

  • GTPase GES
  • GTPase-regulating endothelial cell sprouting
  • GTP-binding protein REM 1
  • MGC48669
  • Rad and Gem-like GTP-binding protein 1
  • RAS (RAD and GEM)-like GTP-binding 1
  • RAS (RAD and GEM)-like GTP-binding
  • REM


The protein encoded by this gene is a GTPase and member of the RAS-like GTP-binding protein family. The encoded protein is expressed in endothelial cells, where it promotes reorganization of the actin cytoskeleton and morphological changes in the cells.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB, Neut
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Rt
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: IHC
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
Species: Hu, Mu, Rt
Applications: IHC
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB

Publications for REM1 Antibody (NBP1-55506) (0)

There are no publications for REM1 Antibody (NBP1-55506).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for REM1 Antibody (NBP1-55506) (0)

There are no reviews for REM1 Antibody (NBP1-55506). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for REM1 Antibody (NBP1-55506) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional REM1 Products

Bioinformatics Tool for REM1 Antibody (NBP1-55506)

Discover related pathways, diseases and genes to REM1 Antibody (NBP1-55506). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for REM1 Antibody (NBP1-55506)

Discover more about diseases related to REM1 Antibody (NBP1-55506).

Pathways for REM1 Antibody (NBP1-55506)

View related products by pathway.

PTMs for REM1 Antibody (NBP1-55506)

Learn more about PTMs related to REM1 Antibody (NBP1-55506).

Research Areas for REM1 Antibody (NBP1-55506)

Find related products by research area.

Blogs on REM1

There are no specific blogs for REM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our REM1 Antibody and receive a gift card or discount.


Gene Symbol REM1