RASAL1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: RASAL1 Antibody [NBP2-13204] - Staining of human cell line U-2 OS shows positivity in plasma membrane and cytoplasm.

Immunohistochemistry-Paraffin: RASAL1 Antibody [NBP2-13204] - Staining of human adrenal gland shows strong membranous with additional cytoplasmic and nuclear positivity in glandular cells.

Staining of human skin shows strong cytoplasmic positivity in squamous epithelial cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RASAL1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RASAL1 Antibody - BSA Free (NBP2-13204) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: RTHSAVTLGDWSDPLDPDAEAQTVYRQLLLGRDQLRLKLLEDSNMDTTLEADTGACPEVLARQRAATARLLEVLADLDRAHEEFQQQER
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RASAL1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RASAL1 Protein (NBP2-13204PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RASAL1 Antibody - BSA Free

• RAS protein activator like 1 (GAP1 like)
• RASALGAP1 like protein
• rasGAP-activating-like protein 1

Background

RASAL1 is encoded by this gene is member of the GAP1 family of GTPase-activating proteins. These proteins stimulate the GTPase activity of normal RAS p21 but not its oncogenic counterpart. Acting as a suppressor of RAS function, the protein enhances the weak intrinsic GTPase activity of RAS proteins resulting in the inactive GDP-bound form of RAS, thereby allowing control of cellular proliferation and differentiation. This particular family member contains domains which are characteristic of the GAP1 subfamily of RasGAP proteins but, in contrast to the other GAP1 family members, this protein is strongly and selectively expressed in endocrine tissues.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RASAL1