RASAL1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: RASAL1 Antibody [NBP2-13204] - Staining of human cell line U-2 OS shows positivity in plasma membrane and cytoplasm.
Immunohistochemistry-Paraffin: RASAL1 Antibody [NBP2-13204] - Staining of human adrenal gland shows strong membranous with additional cytoplasmic and nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RASAL1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RTHSAVTLGDWSDPLDPDAEAQTVYRQLLLGRDQLRLKLLEDSNMDTTLE ADTGACPEVLARQRAATARLLEVLADLDRAHEEFQQQER
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RASAL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RASAL1 Protein (NBP2-13204PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RASAL1 Antibody

  • RAS protein activator like 1 (GAP1 like)
  • RASALGAP1 like protein
  • rasGAP-activating-like protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13203
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-20081
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5094
Species: Hu, Mu, Rt
Applications: WB
NBP1-88644
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89334
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83002
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-34046
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56326
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-24640
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
NB300-155
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56519
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, IHC-FrFl
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91830
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
AF1936
Species: Hu
Applications: WB, IP
NBP1-89794
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13204
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for RASAL1 Antibody (NBP2-13204) (0)

There are no publications for RASAL1 Antibody (NBP2-13204).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RASAL1 Antibody (NBP2-13204) (0)

There are no reviews for RASAL1 Antibody (NBP2-13204). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RASAL1 Antibody (NBP2-13204) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RASAL1 Products

Bioinformatics Tool for RASAL1 Antibody (NBP2-13204)

Discover related pathways, diseases and genes to RASAL1 Antibody (NBP2-13204). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RASAL1 Antibody (NBP2-13204)

Discover more about diseases related to RASAL1 Antibody (NBP2-13204).
 

Pathways for RASAL1 Antibody (NBP2-13204)

View related products by pathway.

PTMs for RASAL1 Antibody (NBP2-13204)

Learn more about PTMs related to RASAL1 Antibody (NBP2-13204).
 

Research Areas for RASAL1 Antibody (NBP2-13204)

Find related products by research area.

Blogs on RASAL1

There are no specific blogs for RASAL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RASAL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RASAL1