Home » RASAL1 » RASAL1 Antibodies » RASAL1 Antibody

RASAL1 Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: RASAL1 Antibody [NBP2-13204] - Staining of human cell line U-2 OS shows positivity in plasma membrane and cytoplasm.
Immunocytochemistry/ Immunofluorescence: RASAL1 Antibody [NBP2-13204] - Staining of human cell line U-2 OS shows positivity in plasma membrane and cytoplasm.
Immunohistochemistry-Paraffin: RASAL1 Antibody [NBP2-13204] - Staining of human adrenal gland shows strong membranous with additional cytoplasmic and nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

RASAL1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RTHSAVTLGDWSDPLDPDAEAQTVYRQLLLGRDQLRLKLLEDSNMDTTLE ADTGACPEVLARQRAATARLLEVLADLDRAHEEFQQQER
Specificity
Specificity of human RASAL1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RASAL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RASAL1 Protein (NBP2-13204PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RASAL1 Antibody

  • RAS protein activator like 1 (GAP1 like)
  • RASALGAP1 like protein
  • rasGAP-activating-like protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

RASA4 Antibody
NBP2-13203
Western Blot: RASA4 Antibody [NBP2-13203] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: RASA4 Antibody [NBP2-13203] - Staining of human kidney shows strong cytoplasmic and membranous positivity in a subset of renal tubules.
Species: Hu
Applications: WB, IHC, IHC-P
RASA3 Antibody
NBP2-20081
Western Blot: RASA3 Antibody [NBP2-20081] - Various whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with RASA3 antibody [C2C3], C-term diluted at 1:500. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: RASA3 Antibody [NBP2-20081] - SK-N-SH cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: RASA3 protein stained by RASA3 antibody [C2C3], C-term diluted at 1:500.Blue: Hoechst 33342 staining. Scale bar = 10 um.
Immunohistochemistry-Paraffin: RASA3 Antibody [NBP2-20081] - Immunohistochemical analysis of paraffin-embedded MCF7 xenograft, using antibody at 1:100 dilution.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Ras-GAP Antibody
AF5094
Western blot shows lysates of TT human medullary thyroid cancer cell line, C2C12 mouse myoblast cell line, and Rat‑2 rat embryonic fibroblast cell line. PVDF membrane was probed with 1 µg/mL of Human/Mouse/Rat Ras‑GAP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5094) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Ras‑GAP at approximately 120 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB
PITX1 Antibody
NBP1-88644
Immunocytochemistry/Immunofluorescence: PITX1 Antibody [NBP1-88644] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli.
Immunohistochemistry-Paraffin: PITX1 Antibody [NBP1-88644] - Staining of human esophagus shows strong nuclear positivity in squamous epithelial cells.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
LRPAP Antibody
NBP1-89334
Western Blot: LRPAP Antibody [NBP1-89334] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/Immunofluorescence: LRPAP Antibody [NBP1-89334] - Immunofluorescent staining of human cell line A-431 shows localization to endoplasmic reticulum.
Immunohistochemistry-Paraffin: LRPAP Antibody [NBP1-89334] - Staining of human placenta shows strong positivity in trophoblastic cells.
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
RAP1GAP Antibody
NBP1-83002
Immunocytochemistry/Immunofluorescence: RAP1GAP Antibody [NBP1-83002] - Staining of mouse hippocampus shows cytoplasmic positivity in a subset of interneurons in the CA1 area.
Immunohistochemistry-Paraffin: RAP1GAP Antibody [NBP1-83002] - Staining of human cerebellum shows strong cytoplasmic immunoreactivity in Purkinje cells and neurons in the molecular layer.
Immunocytochemistry/Immunofluorescence: RAP1GAP Antibody [NBP1-83002] - Staining of mouse midbrain shows strong immunoreactivity in locus coeruleus neurons.
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Phenylalanine
Hydroxylase Antibody
NBP1-52084
Western Blot: Phenylalanine Hydroxylase Antibody [NBP1-52084] - (0.1ug/ml) staining of Mouse (A) and Rat (B) Liver lysate (35ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
Immunohistochemistry-Paraffin: Phenylalanine Hydroxylase Antibody [NBP1-52084] - Staining of paraffin embedded Human Kidney. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Western Blot: Phenylalanine Hydroxylase Antibody [NBP1-52084] - Analysis of Phenylalanine Hydroxylase Human Liver lysate (35ug protein in RIPA buffer) using this antibody at 0.3 ug/ml. Primary incubation was 1 hour. Detected by chemiluminescence.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
Pleckstrin
Antibody (OTI6H8)
NBP2-02300
Western Blot: Pleckstrin Antibody (6H8) [NBP2-02300] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Pleckstrin (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Pleckstrin.
Immunohistochemistry-Paraffin: Pleckstrin Antibody (6H8) [NBP2-02300] Staining of paraffin-embedded prostate tissue using anti-Pleckstrin mouse monoclonal antibody.
Flow Cytometry: Pleckstrin Antibody (6H8) [NBP2-02300] - HEK293T cells transfected with either pCMV6-ENTRY Pleckstrin.(Red) or empty vector control plasmid (Blue) were immunostained with anti-Pleckstrin mouse monoclonal, and then analyzed by flow cytometry.
Species: Hu
Applications: WB, Flow, IHC, IHC-P
SynGAP Antibody
NBP1-87841
Immunocytochemistry/Immunofluorescence: SynGAP Antibody [NBP1-87841] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus.
Immunohistochemistry-Paraffin: SynGAP Antibody [NBP1-87841] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: SynGAP Antibody [NBP1-87841] - Staining of human hippocampus shows positivity in neuronal processes.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MeCP2 Antibody
NB100-56326
Western Blot: MeCP2 Antibody [NB100-56326] - analysis of MeCP2 in HeLa cell lysate using this antibody.
Immunocytochemistry/Immunofluorescence: MeCP2 Antibody [NB100-56326] - MeCP2 antibody was tested in A431 cells at a 1:200 dilution against Dylight 488 (Green). Alpha tubulin and nuclei were counterstained against Dylight 568 (Red) and DAPI (Blue), respectively.
Immunohistochemistry-Paraffin: MeCP2 Antibody [NB100-56326] - IHC analysis of a formalin fixed paraffin embedded section of mouse liver tissue using MeCP2 antibody at 1:500 dilution. The antibody generated a very strong/specific nuclear staining with weak to negligible cytoplasmic signal in the hepatocytes, kupffer cells, and in the endothelial cells of blood vessels.
(1 Publication)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
p53 Antibody (PAb
240)
NB200-103
Western Blot: p53 Antibody (PAb 240) [NB200-103] - WB analysis of p53 in MCF7 and HeLa lystates. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: p53 Antibody (PAb 240) [NB200-103] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-p53 (PAb 240) [NB200-103] at a 1:200 dilution overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: p53 Antibody (PAb 240) [NB200-103] - p53 was detected in immersion fixed paraffin-embedded sections of human prostate cancer using anti-human mouse monoclonal antibody (Catalog # NB200-103) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue).Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
(2 Reviews)
(22 Publications)
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
GPR35 Antibody
NBP2-24640
Western Blot: GPR35 Antibody [NBP2-24640] - Analysis of G Protein-Coupled Receptor GPR35 in MCF7 cell lysate in the 1) absence and 2) presence of immunizing peptide 3) RAW using NBP2-24640 at 0.5 ug/ml and 1.0 ug/ml, respectively.
Immunohistochemistry-Paraffin: GPR35 Antibody [NBP2-24640] - Analysis of GPR35 in paraffin-embedded formalin-fixed MCF7cells using an isotype control (top left) and NBP2-24640 (bottom left, right) at 5 ug/ml.
(1 Publication)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
Neurofibromin 1
Antibody
NB300-155
Western Blot: Neurofibromin 1 Antibody [NB300-155] - Western Blot of (A, B, C above).
Immunohistochemistry: Neurofibromin 1 Antibody [NB300-155] - NF1 protein labeling displays positive signal in the maturing and the hypertrophic cartilages but only faint labeling in the proliferative cartilage.
(4 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
DNMT1 Antibody
(60B1220.1)
NB100-56519
Western Blot: DNMT1 Antibody (60B1220.1) [NB100-56519] - analysis of Dnmt1 in 2102EP (human embryonic carcinoma) in the A) absence and B) presence of immunizing peptide, recombinant human Dnmt1 protein in the C) absence and D) presence of immunizing peptide, NIH 3T3 (mouse embryonic fribroblast) in the E) absence and F) presence of immunizing peptide, and D3 (mouse embryonic stem cell) in the G) absence and H) presence of immunizing peptide using Dnmt1 antibody. this antibody. 5 ug/ml for testing the human cell line and 0.1 ug/ml was used for testing the recombinant protein and the mouse cell lines. ’s goat anti-mouse Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
Immunocytochemistry/Immunofluorescence: DNMT1 Antibody (60B1220.1) [NB100-56519] - Dnmt1 antibody was tested in HeLa cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red). An antibody dilution of 1:10 was used. Image objective 40x.
Immunohistochemistry-Paraffin: DNMT1 Antibody (60B1220.1) [NB100-56519] - IHC-P validation of DNMT1 antibody (clone 60B1220.1) on formalin fixed and paraffin embedded tissue section of human hepatocellular carcinoma at 1:50 dilution.
(2 Reviews)
(109 Publications)
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, IHC-FrFl
hnRNP C1 + C2
Antibody (CL2596)
NBP2-36777
Western Blot: hnRNP C1 + C2 Antibody (CL2596) [NBP2-36777] - Analysis of extracts from U-251 cells, transfected with: control siRNA, target specific siRNA probe #1, target specific siRNA probe #2, using Anti-HNRNPC monoclonal antibody. Downregulation of antibody signal confirms target specificity. Remaining % inten
Immunocytochemistry/Immunofluorescence: hnRNP C1 + C2 Antibody (CL2596) [NBP2-36777] - Staining in U251 cell line showing distinct nuclear (without nucleoli)Staining in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.
Immunohistochemistry: hnRNP C1 + C2 Antibody (CL2596) [NBP2-36777] - Staining of human lymph node shows strong nuclear immunoreactivity in lymphocytes.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Dexras1 Antibody
NBP1-91830
Western Blot: Dexras1 Antibody [NBP1-91830] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: Dexras1 Antibody [NBP1-91830] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm & plasma membrane.
Immunohistochemistry-Paraffin: Dexras1 Antibody [NBP1-91830] - Staining of human urinary bladder shows moderate cytoplasmic and nuclear positivity in urothelial cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AHR Antibody
NB100-128
Immunocytochemistry/Immunofluorescence: AHR Antibody [NB100-128] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti AHR [NB100-128] at a 1:100 dilution overnight at 4C and detected with an anti-goat Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: AHR Antibody [NB100-128] - IHC analysis of formalin fixed paraffin-embedded (FFPE) human liver using 20 ug/ml conc. of AHR antibody on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) using 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching with peroxide block. The sections were incubated with primary antibody for 30 minutes and Bond Polymer Refine Detection (Leica Biosystems) with DAB was used for signal development followed by counterstaining with hematoxylin. Whole slide scanning and capturing of representative images was performed using Aperio AT2 (Leica Biosystems). Staining was performed by Histowiz.
Gel Super Shift Assays: AHR Antibody [NB100-128] - EMSA validation of AHR antibody on U937 cells nuclear protein. Image submitted by verified customer - see review for protocol details.
(1 Review)
(11 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
Complement
Component C2b Antibod ...
MAB1936
Complement Component C2b Antibody (269716)
(1 Publication)
Species: Hu
Applications: WB, IP
GAP1m Antibody
NBP1-89794
Western Blot: GAP1m Antibody [NBP1-89794] - Analysis in human cell lines A-431 and PC-3 using anti-RASA2 antibody. Corresponding RASA2 RNA-seq data are presented for the same cell lines. Loading control: anti-PFN1.
Immunocytochemistry/Immunofluorescence: GAP1m Antibody [NBP1-89794] - Immunofluorescent staining of human cell line A-431 shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: GAP1m Antibody [NBP1-89794] - Staining in human small intestine and skeletal muscle tissues. Corresponding RASA2 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
RASAL1 Antibody
NBP2-13204
RASAL1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for RASAL1 Antibody (NBP2-13204) (0)

There are no publications for RASAL1 Antibody (NBP2-13204).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RASAL1 Antibody (NBP2-13204) (0)

There are no reviews for RASAL1 Antibody (NBP2-13204). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RASAL1 Antibody (NBP2-13204) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RASAL1 Products

Bioinformatics Tool for RASAL1 Antibody (NBP2-13204)

Discover related pathways, diseases and genes to RASAL1 Antibody (NBP2-13204). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RASAL1 Antibody (NBP2-13204)

Discover more about diseases related to RASAL1 Antibody (NBP2-13204).
 

Pathways for RASAL1 Antibody (NBP2-13204)

View related products by pathway.

PTMs for RASAL1 Antibody (NBP2-13204)

Learn more about PTMs related to RASAL1 Antibody (NBP2-13204).
 

Research Areas for RASAL1 Antibody (NBP2-13204)

Find related products by research area.

Blogs on RASAL1

There are no specific blogs for RASAL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RASAL1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol RASAL1