Home » RASAL1 » RASAL1 Antibodies » RASAL1 Antibody

RASAL1 Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: RASAL1 Antibody [NBP2-13204] - Staining of human cell line U-2 OS shows positivity in plasma membrane and cytoplasm.
Immunocytochemistry/ Immunofluorescence: RASAL1 Antibody [NBP2-13204] - Staining of human cell line U-2 OS shows positivity in plasma membrane and cytoplasm.
Immunohistochemistry-Paraffin: RASAL1 Antibody [NBP2-13204] - Staining of human adrenal gland shows strong membranous with additional cytoplasmic and nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

RASAL1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RTHSAVTLGDWSDPLDPDAEAQTVYRQLLLGRDQLRLKLLEDSNMDTTLE ADTGACPEVLARQRAATARLLEVLADLDRAHEEFQQQER
Specificity
Specificity of human RASAL1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RASAL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RASAL1 Protein (NBP2-13204PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RASAL1 Antibody

  • RAS protein activator like 1 (GAP1 like)
  • RASALGAP1 like protein
  • rasGAP-activating-like protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

RASA4 Antibody
NBP2-15089
Western Blot: RASA4 Antibody [NBP2-15089] - Sample (30 ug of whole cell lysate) A: 293T B: A431 C: HeLa 7. 5% SDS PAGE, antibody diluted at 1:3000.
Immunocytochemistry/Immunofluorescence: RASA4 Antibody [NBP2-15089] - Analysis of methanol-fixed HeLa, using antibody at 1:500 dilution.
Species: Hu
Applications: WB, ICC/IF
RASA3 Antibody
NBP2-20081
Western Blot: RASA3 Antibody [NBP2-20081] - Various whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with RASA3 antibody [C2C3], C-term diluted at 1:500. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: RASA3 Antibody [NBP2-20081] - SK-N-SH cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: RASA3 protein stained by RASA3 antibody [C2C3], C-term diluted at 1:500.Blue: Hoechst 33342 staining. Scale bar = 10 um.
Immunohistochemistry-Paraffin: RASA3 Antibody [NBP2-20081] - Immunohistochemical analysis of paraffin-embedded MCF7 xenograft, using antibody at 1:100 dilution.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Ras-GAP Antibody
AF5094
Western blot shows lysates of TT human medullary thyroid cancer cell line, C2C12 mouse myoblast cell line, and Rat‑2 rat embryonic fibroblast cell line. PVDF membrane was probed with 1 µg/mL of Human/Mouse/Rat Ras‑GAP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5094) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Ras‑GAP at approximately 120 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB
PITX1 Antibody
NBP1-88644
Immunocytochemistry/Immunofluorescence: PITX1 Antibody [NBP1-88644] - Staining of human cell line U-2 OS shows localization to nucleoli. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PITX1 Antibody [NBP1-88644] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: PITX1 Antibody [NBP1-88644] - Saining of human esophagus shows moderate to strong nuclear positivity in squamous epithelial cells.
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
LRPAP Antibody
NBP1-89334
Western Blot: LRPAP Antibody [NBP1-89334] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Mouse Cerebral Cortex tissue
Immunocytochemistry/Immunofluorescence: LRPAP Antibody [NBP1-89334] - Staining of human cell line A-431 shows localization to endoplasmic reticulum. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: LRPAP Antibody [NBP1-89334] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
RAP1GAP Antibody
NBP1-83002
Immunohistochemistry: RAP1GAP Antibody [NBP1-83002] - Staining of mouse hippocampus shows cytoplasmic positivity in a subset of interneurons in the CA1 area.
Immunohistochemistry-Paraffin: RAP1GAP Antibody [NBP1-83002] - Staining of human kidney shows strong positivity in distal tubules and Bowman's capsule.
Immunohistochemistry-Paraffin: RAP1GAP Antibody [NBP1-83002] - Staining of human hippocampus shows cytoplasmic positivity in neuronal cells.
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P
Phenylalanine
Hydroxylase Antibody
NBP1-52084
Western Blot: Phenylalanine Hydroxylase Antibody [NBP1-52084] - (0.1ug/ml) staining of Mouse (A) and Rat (B) Liver lysate (35ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
Immunohistochemistry-Paraffin: Phenylalanine Hydroxylase Antibody [NBP1-52084] - Staining of paraffin embedded Human Kidney. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Western Blot: Phenylalanine Hydroxylase Antibody [NBP1-52084] - Analysis of Phenylalanine Hydroxylase Human Liver lysate (35ug protein in RIPA buffer) using this antibody at 0.3 ug/ml. Primary incubation was 1 hour. Detected by chemiluminescence.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
Pleckstrin Antibody
NB100-1343
Western Blot: Pleckstrin Antibody [NB100-1343] - Staining of Human Parathyroid lysate (A) and negative control HepG2 (B) cell lysate (35ug protein in RIPA buffer). Antibody at 0.01 ug/mL. Detected by chemiluminescence.
Immunocytochemistry/Immunofluorescence: Pleckstrin Antibody [NB100-1343] - Analysis of paraformaldehyde fixed HeLa cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL), showing cytoplasmic/membrane and nuclear staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL).
Immunohistochemistry-Paraffin: Pleckstrin Antibody [NB100-1343] - Staining of paraffin embedded Human Spleen. Antibody at 3.75 ug/mL. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
(2 Publications)
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
SynGAP Antibody
NBP2-27541
Western Blot: SynGAP Antibody [NBP2-27541] - (0.03 ug/ml) staining of Mouse Brain lysate (35 ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
(2 Publications)
Species: Mu
Applications: WB, PEP-ELISA
MeCP2 Antibody
NB600-1101
Western Blot: MeCP2 Antibody [NB600-1101] - Analysis of HeLa cell extract.
Immunocytochemistry/Immunofluorescence: MeCP2 Antibody [NB600-1101] - Analysis of Methyl CpG Binding Protein 2 (green) showing staining in the nucleus of C2C12 cells (right) compared to a negative control without primary antibody (left).
Immunohistochemistry-Paraffin: MeCP2 Antibody [NB600-1101] - Staining in the nucleus of rat brain tissue (right) compared to a negative control without primary antibody (left).
(4 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
p53 Antibody (PAb
240)
NB200-103
Western Blot: p53 Antibody (PAb 240) [NB200-103] - Analysis of p53 in MCF7 and HeLa lystates. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: p53 Antibody (PAb 240) [NB200-103] - PC12 cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.5% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-p53 Antibody (PAb 240) NB200-103 at 2 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: p53 Antibody (PAb 240) [NB200-103] - p53 was detected in immersion fixed paraffin-embedded sections of human prostate cancer using anti-human mouse monoclonal antibody (Catalog # NB200-103) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue). Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
(3 Reviews)
(28 Publications)
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
GPR35 Antibody
NBP2-24640
Western Blot: GPR35 Antibody [NBP2-24640] - Analysis of G Protein-Coupled Receptor GPR35 in MCF7 cell lysate in the 1) absence and 2) presence of immunizing peptide 3) RAW using NBP2-24640 at 0.5 ug/ml and 1.0 ug/ml, respectively.
Immunohistochemistry-Paraffin: GPR35 Antibody [NBP2-24640] - Analysis of GPR35 in paraffin-embedded formalin-fixed MCF7cells using an isotype control (top left) and NBP2-24640 (bottom left, right) at 5 ug/ml.
(4 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Neurofibromin 1
Antibody
NB300-155
Western Blot: Neurofibromin 1 Antibody [NB300-155] - Western Blot of (A, B, C above).
Immunohistochemistry: Neurofibromin 1 Antibody [NB300-155] - NF1 protein labeling displays positive signal in the maturing and the hypertrophic cartilages but only faint labeling in the proliferative cartilage.
(4 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
DNMT1 Antibody
(60B1220.1)
NB100-56519
Western Blot: DNMT1 Antibody (60B1220.1) [NB100-56519] - Analysis of Dnmt1 in 2102EP (human embryonic carcinoma) in the A) absence and B) presence of immunizing peptide, recombinant human Dnmt1 protein in the C) absence and D) presence of immunizing peptide, NIH 3T3 (mouse embryonic fribroblast) in the E) absence and F) presence of immunizing peptide, and D3 (mouse embryonic stem cell) in the G) absence and H) presence of immunizing peptide using Dnmt1 antibody. this antibody. 5 ug/ml for testing the human cell line and 0.1 ug/ml was used for testing the recombinant protein and the mouse cell lines. ’s goat anti-mouse Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
Immunocytochemistry/Immunofluorescence: DNMT1 Antibody (60B1220.1) [NB100-56519] - Dnmt1 antibody was tested in HeLa cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red). Antibody dilution of 1:10 was used. Image objective 40x.
Immunohistochemistry-Paraffin: DNMT1 Antibody (60B1220.1) [NB100-56519] - Tissue section of human hepatocellular carcinoma at 1:50 dilution.
(4 Reviews)
(119 Publications)
Species: Hu, Mu, Rt, Po, Bv, Sh
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC, IHC-FrFl, KD
hnRNP C1 + C2
Antibody (SN0652)
NBP2-67656
Western Blot: hnRNP C1 + C2 Antibody (SN0652) [NBP2-67656] - Analysis of hnRNP C1+C2 on different lysates using anti-hnRNP C1+C2 antibody at 1/1,000 dilution. Positive control: Lane 1: Hela Lane 2: MCF-7 Lane 3: HepG2
Immunocytochemistry/Immunofluorescence: hnRNP C1 + C2 Antibody (SN0652) [NBP2-67656] - Staining hnRNP C1+C2 in B16-F1 (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: hnRNP C1 + C2 Antibody (SN0652) [NBP2-67656] - Analysis of paraffin-embedded mouse skin tissue using anti-hnRNP C1+C2 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Dexras1 Antibody
NBP1-91830
Western Blot: Dexras1 Antibody [NBP1-91830] - Analysis in control (vector only transfected HEK293T lysate) and RASD1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: Dexras1 Antibody [NBP1-91830] - Staining of human cell line MCF7 shows localization to nucleoplasm & plasma membrane. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Dexras1 Antibody [NBP1-91830] - Staining of human testis shows moderate to strong cytoplasmic, membranous and nuclear positivity in cells in seminiferous ducts.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AHR Antibody
NB100-128
Immunocytochemistry/Immunofluorescence: AHR Antibody [NB100-128] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton X-100. The cells were incubated with anti AHR [NB100-128] at a 1:100 dilution overnight at 4C and detected with an anti-goat DyLight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: AHR Antibody [NB100-128] - Analysis of FFPE human liver using 1:200 conc. of AHR antibody on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) using 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching with peroxide block. The sections were incubated with primary antibody for 30 minutes and Bond Polymer Refine Detection (Leica Biosystems) with DAB was used for signal development followed by counterstaining with hematoxylin. Whole slide scanning and capturing of representative images was performed using Aperio AT2 (Leica Biosystems). Staining was performed by Histowiz.
Gel Super Shift Assays: AHR Antibody [NB100-128] - EMSA validation of AHR antibody on U937 cells nuclear protein. Image submitted by verified customer - see review for protocol details.
(1 Review)
(12 Publications)
Species: Hu, Mu, Rt
Applications: GS, ICC/IF, IHC, IHC-P
Human Complement
Component C2 ELISA Ki ...
NBP2-60548
ELISA: Human Complement Component C2 ELISA Kit (Colorimetric) [NBP2-60548] - Standard curve.
Species: Hu
GAP1m Antibody
NBP1-89794
Western Blot: GAP1m Antibody [NBP1-89794] - Analysis in human cell lines A-431 and PC-3 using anti-RASA2 antibody. Corresponding RASA2 RNA-seq data are presented for the same cell lines. Loading control: anti-PFN1.
Immunocytochemistry/Immunofluorescence: GAP1m Antibody [NBP1-89794] - Staining of human cell line A-431 shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: GAP1m Antibody [NBP1-89794] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
RASAL1 Antibody
NBP2-13204
RASAL1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for RASAL1 Antibody (NBP2-13204) (0)

There are no publications for RASAL1 Antibody (NBP2-13204).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RASAL1 Antibody (NBP2-13204) (0)

There are no reviews for RASAL1 Antibody (NBP2-13204). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RASAL1 Antibody (NBP2-13204) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional RASAL1 Products

Bioinformatics Tool for RASAL1 Antibody (NBP2-13204)

Discover related pathways, diseases and genes to RASAL1 Antibody (NBP2-13204). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RASAL1 Antibody (NBP2-13204)

Discover more about diseases related to RASAL1 Antibody (NBP2-13204).
 

Pathways for RASAL1 Antibody (NBP2-13204)

View related products by pathway.

PTMs for RASAL1 Antibody (NBP2-13204)

Learn more about PTMs related to RASAL1 Antibody (NBP2-13204).
 

Research Areas for RASAL1 Antibody (NBP2-13204)

Find related products by research area.

Blogs on RASAL1

There are no specific blogs for RASAL1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RASAL1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol RASAL1