Dexras1 Antibody


Western Blot: Dexras1 Antibody [NBP1-91830] - Analysis in control (vector only transfected HEK293T lysate) and RASD1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T more
Immunocytochemistry/ Immunofluorescence: Dexras1 Antibody [NBP1-91830] - Staining of human cell line MCF7 shows localization to nucleoplasm & plasma membrane. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Dexras1 Antibody [NBP1-91830] - Staining of human testis shows moderate to strong cytoplasmic, membranous and nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: Dexras1 Antibody [NBP1-91830] - Staining of human cerebral cortex shows weak cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: Dexras1 Antibody [NBP1-91830] - Staining of human kidney shows strong membranous and cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: Dexras1 Antibody [NBP1-91830] - Staining of human placenta shows moderate cytoplasmic and membranous positivity in trophoblastic cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

Dexras1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: TKENVDVPLVICGNKGDRDFYREVDQREIEQLVGDDPQRCAYFE
Specificity of human Dexras1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Dexras1 Protein (NBP1-91830PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Dexras1 Antibody

  • Activator of G-protein signaling 1
  • AGS1ras-related protein
  • DEXRAS1dexamethasone-induced Ras-related protein 1
  • MGC:26290
  • RAS, dexamethasone-induced 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Gp
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, IHC-WhMt
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P, IF
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
Species: Hu, Mu, Rt
Applications: WB, IHC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for Dexras1 Antibody (NBP1-91830) (0)

There are no publications for Dexras1 Antibody (NBP1-91830).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Dexras1 Antibody (NBP1-91830) (0)

There are no reviews for Dexras1 Antibody (NBP1-91830). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Dexras1 Antibody (NBP1-91830) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional Dexras1 Products

Bioinformatics Tool for Dexras1 Antibody (NBP1-91830)

Discover related pathways, diseases and genes to Dexras1 Antibody (NBP1-91830). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Dexras1 Antibody (NBP1-91830)

Discover more about diseases related to Dexras1 Antibody (NBP1-91830).

Pathways for Dexras1 Antibody (NBP1-91830)

View related products by pathway.

PTMs for Dexras1 Antibody (NBP1-91830)

Learn more about PTMs related to Dexras1 Antibody (NBP1-91830).

Research Areas for Dexras1 Antibody (NBP1-91830)

Find related products by research area.

Blogs on Dexras1

There are no specific blogs for Dexras1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Dexras1 Antibody and receive a gift card or discount.


Gene Symbol RASD1