GAP1m Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: GAP1m Antibody [NBP1-89794] - Staining of human cell line A-431 shows localization to vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: GAP1m Antibody [NBP1-89794] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: GAP1m Antibody [NBP1-89794] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: GAP1m Antibody [NBP1-89794] - Staining of human prostate shows weak to moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: GAP1m Antibody [NBP1-89794] - Staining of human skeletal muscle shows very weak cytoplasmic positivity in monocytes.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GAP1m Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GAP1m Antibody - BSA Free (NBP1-89794) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-GAP1m Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PDDYSNFVIEDSVTTFKTIQQIKSIIEKLDEPHEKYRKKRSSSAKYGSKENPIVGKAS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RASA2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot Reactivity reported in (PMID: 36002574)
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  GAP1m Protein (NBP1-89794PEP)

Reactivity Notes

Mouse 86%, Rat 86%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for GAP1m Antibody - BSA Free

• RASA2 RAS p21 protein activator 2
• RASA2

Background

GAP1M is a member of the GAP1 family of GTPase-activating proteins. GAP1m stimulates the GTPase activity of normal RAS p21 but not its oncogenic counterpart. Acting as a suppressor of RAS function, the protein enhances the weak intrinsic GTPase activity of RAS proteins resulting in the inactive GDP-bound form of RAS, thereby allowing control of cellular proliferation and differentiation. This particular family member has a perinuclear localization and is an inositol 1,3,4,5-tetrakisphosphate-binding protein; a compound suggested to function as a second messenger. [provided by RefSeq, Jul 2008]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GAP1m Antibody (NBP1-89794)(1)

Publication using NBP1-89794

• Carnevale J, Shifrut E, Kale N et al. RASA2 ablation in T cells boosts antigen sensitivity and long-term function Nature 2022-09-01 [PMID: 36002574] (WB, Human)

Bioinformatics

• Gene Symbol: RASA2