GAP1m Antibody

Images

 
Western Blot: GAP1m Antibody [NBP1-89794] - Analysis in human cell line A-431.
Immunocytochemistry/ Immunofluorescence: GAP1m Antibody [NBP1-89794] - Immunofluorescent staining of human cell line A-431 shows localization to vesicles.
Immunohistochemistry-Paraffin: GAP1m Antibody [NBP1-89794] - Staining of human skeletal muscle shows very weak cytoplasmic positivity in monocytes.
Immunohistochemistry-Paraffin: GAP1m Antibody [NBP1-89794] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: GAP1m Antibody [NBP1-89794] - Staining of human prostate shows weak to moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: GAP1m Antibody [NBP1-89794] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GAP1m Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PDDYSNFVIEDSVTTFKTIQQIKSIIEKLDEPHEKYRKKRSSSAKYGSKENPIVGKAS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RASA2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GAP1m Protein (NBP1-89794PEP)

Reactivity Notes

Mouse 86%, Rat 86%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GAP1m Antibody

  • RASA2 RAS p21 protein activator 2
  • RASA2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NB300-155
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-82112
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-85383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-79781
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-92192
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59109
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89416
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00000420-B01P
Species: Hu
Applications: WB
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
H00006464-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, PLA
AF5094
Species: Hu, Mu, Rt
Applications: WB
NBP2-54602
Species: Vi
Applications: WB, ELISA, Flow, ICC/IF
NBP1-19151
Species: Hu, Ma
Applications: WB, IHC-P, IP
NBP1-89794
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for GAP1m Antibody (NBP1-89794) (0)

There are no publications for GAP1m Antibody (NBP1-89794).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GAP1m Antibody (NBP1-89794) (0)

There are no reviews for GAP1m Antibody (NBP1-89794). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GAP1m Antibody (NBP1-89794) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GAP1m Products

GAP1m NBP1-89794

Bioinformatics Tool for GAP1m Antibody (NBP1-89794)

Discover related pathways, diseases and genes to GAP1m Antibody (NBP1-89794). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GAP1m Antibody (NBP1-89794)

Discover more about diseases related to GAP1m Antibody (NBP1-89794).
 

Pathways for GAP1m Antibody (NBP1-89794)

View related products by pathway.

PTMs for GAP1m Antibody (NBP1-89794)

Learn more about PTMs related to GAP1m Antibody (NBP1-89794).

Blogs on GAP1m

There are no specific blogs for GAP1m, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GAP1m Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RASA2