PITX1 Antibody (5G4)

Western Blot: PITX1 Antibody (5G4) [H00005307-M01] - Analysis of PITX1 expression in transfected 293T cell line by PITX1 monoclonal antibody (M01), clone 5G4.Lane 1: PITX1 transfected lysate(34.1 KDa).Lane 2: Non-transfected lysate.

Western Blot: PITX1 Antibody (5G4) [H00005307-M01] - Analysis of PITX1 over-expressed 293 cell line, cotransfected with PITX1 Validated Chimera RNAi ( Cat # H00005307-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PITX1 monoclonal antibody (M01), clone 5G4 (Cat # H00005307-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.

Western Blot: PITX1 Antibody (5G4) [H00005307-M01] - PITX1 monoclonal antibody (M01), clone 5G4 Analysis of PITX1 expression in Hela S3 NE.

Western Blot: PITX1 Antibody (5G4) [H00005307-M01] - Analysis of PITX1 transfected lysate using anti-PITX1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PITX1 MaxPab rabbit polyclonal antibody.

Sandwich ELISA: PITX1 Antibody (5G4) [H00005307-M01] - Detection limit for recombinant GST tagged PITX1 is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, IHC, IP, KD
• Clone: 5G4
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

PITX1 Antibody (5G4) Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: PITX1 (NP_002644, 225 a.a. ~ 313 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPSSMGPGAVPGMPNSGLNNINNLTGSSLNSAMSPGACPYGTPASPYSVYRDTCNSSLASLRLKSKQHSSFGYGGLQGPASGLNACQYN
• Specificity: PITX1 - paired-like homeodomain transcription factor 1
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: PITX1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation
  • Knockdown Validated
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has been used for RNAi Validation and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PITX1 Antibody (5G4)

• BFTpituitary homeobox 1
• CCF
• Hindlimb-expressed homeobox protein backfoot
• Homeobox protein PITX1
• paired-like homeodomain 1
• pituitary otx-related factor
• POTXpituitary homeo box 1
• PTX1Paired-like homeodomain transcription factor 1hindlimb expressed homeobox protein backfoot

Background

This gene encodes a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. Members of this family are involved in organ development and left-right asymmetry. This protein acts as a transcriptional regulator involved in basal and hormone-regulated activity of prolactin.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PITX1 Antibody (H00005307-M01)(3)

Publications using H00005307-M01

• Qiao F, Gong P, Song Y et al. Downregulated PITX1 Modulated by MiR-19a-3p Promotes Cell Malignancy and Predicts a Poor Prognosis of Gastric Cancer by Affecting Transcriptionally Activated PDCD5. Cell Physiol Biochem 2018-05-03 [PMID: 29734189]
• Yamaguchi T, Miki Y, Yoshida K. The c-Abl tyrosine kinase stabilizes Pitx1 in the apoptotic response to DNA damage. Apoptosis;15. 2010-08-01 [PMID: 20563669]
• Liu DX, Lobie PE. Transcriptional activation of p53 by Pitx1. Cell Death Differ. 2007-11-01 [PMID: 17762884]

Bioinformatics

• Gene Symbol: PITX1
• Entrez:
  • 5307(Human)
• OMIM:
  • 602149(Human)
• Uniprot:
  • NP_002644(Human)