LRPAP Antibody

Images

 
Western Blot: LRPAP Antibody [NBP1-89334] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Mouse Cerebral Cortex tissue
Immunocytochemistry/ Immunofluorescence: LRPAP Antibody [NBP1-89334] - Staining of human cell line A-431 shows localization to endoplasmic reticulum. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: LRPAP Antibody [NBP1-89334] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Western Blot: LRPAP Antibody [NBP1-89334] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Western Blot: LRPAP Antibody [NBP1-89334] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells); Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells).
Western Blot: LRPAP Antibody [NBP1-89334] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Cerebral Cortex tissue
Immunohistochemistry-Paraffin: LRPAP Antibody [NBP1-89334] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.
Immunohistochemistry: LRPAP Antibody [NBP1-89334] - Immunofluorescence staining of mouse hypothalamus shows positivity in paraventricular and periventricular nuclei.
Immunohistochemistry-Paraffin: LRPAP Antibody [NBP1-89334] - Staining of human hippocampus shows moderate cytoplasmic positivity in neuronal cells.
Immunohistochemistry: LRPAP Antibody [NBP1-89334] - Immunofluorescence staining of mouse brain shows positivity in neurons in the olfactory bulb.
Immunohistochemistry-Paraffin: LRPAP Antibody [NBP1-89334] - Staining of human skeletal muscle shows weak to no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: LRPAP Antibody [NBP1-89334] - Staining of human placenta shows strong positivity in trophoblastic cells.
Orthogonal Strategies: Immunohistochemistry-Paraffin: LRPAP Antibody [NBP1-89334] - Staining in human placenta and skeletal muscle tissues.. Corresponding LRPAP1 RNA-seq data are presented for the same tissues.
Immunohistochemistry: LRPAP Antibody [NBP1-89334] - Staining of mouse piriform cortex shows positivity in neurons.
Immunohistochemistry: LRPAP Antibody [NBP1-89334] - Staining of mouse somatosensory cortex shows positivity in neurons.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

LRPAP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RMEKLNQLWEKAQRLHLPPVRLAELHADLKIQERDELAWKKLKLDGLDEDGEKEARLIRNLNVILAKYGLDGKKDARQVTSNSLSGTQEDGLDDPRLEKLWHKAKTSGKFSGEELDKLWREFLHHKEK
Specificity
Specificity of human RPAP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LRPAP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Publications
Read Publications using NBP1-89334.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LRPAP Antibody

  • A2MRAP
  • A2MRAPMRAP
  • A2RAP
  • alpha-2-macroglobulin receptor-associated protein 1
  • alpha-2-macroglobulin receptor-associated protein
  • alpha-2-MRAP
  • HBP44
  • lipoprotein receptor associated protein
  • low density lipoprotein receptor-related protein associated protein 1
  • Low density lipoprotein receptor-related protein-associated protein 1
  • low density lipoprotein-related protein-associated protein 1(alpha-2-macroglobulin receptor-associated protein 1)
  • LRPAP
  • LRPAP1
  • MGC138272
  • RAP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67286
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-67117
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-33560
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KO
NLS6792
Species: Hu, Mu, Po, Bt, Bv, Ca, Eq, Ha, Mk, Pm, Rb
Applications: IHC, IHC-P
NBP2-22526
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
NBP2-75641
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-292
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB110-96417
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-49938
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
AF6240
Species: Hu
Applications: WB, ELISA, IHC
NBP2-24614
Species: Hu, Mu, Rt, Op, Pm
Applications: WB
NBP1-87345
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87343
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-24643
Species: Mu, Rt
Applications: WB
NBP1-86794
Species: Hu
Applications: WB, ICC/IF
NBP1-55238
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB
NBP2-24763
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-89334
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for LRPAP Antibody (NBP1-89334)(2)

Reviews for LRPAP Antibody (NBP1-89334) (0)

There are no reviews for LRPAP Antibody (NBP1-89334). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LRPAP Antibody (NBP1-89334) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional LRPAP Products

Bioinformatics Tool for LRPAP Antibody (NBP1-89334)

Discover related pathways, diseases and genes to LRPAP Antibody (NBP1-89334). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LRPAP Antibody (NBP1-89334)

Discover more about diseases related to LRPAP Antibody (NBP1-89334).
 

Pathways for LRPAP Antibody (NBP1-89334)

View related products by pathway.

PTMs for LRPAP Antibody (NBP1-89334)

Learn more about PTMs related to LRPAP Antibody (NBP1-89334).

Blogs on LRPAP

There are no specific blogs for LRPAP, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LRPAP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LRPAP1