LRPAP Antibody

Images

 
Western Blot: LRPAP Antibody [NBP1-89334] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/ Immunofluorescence: LRPAP Antibody [NBP1-89334] - Immunofluorescent staining of human cell line A-431 shows localization to endoplasmic reticulum.
Immunohistochemistry-Paraffin: LRPAP Antibody [NBP1-89334] - Staining of human lateral ventricle shows cytoplasmic positivity in neuronal cells.
Western Blot: LRPAP Antibody [NBP1-89334] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Western Blot: LRPAP Antibody [NBP1-89334] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells); Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells).
Western Blot: LRPAP Antibody [NBP1-89334] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Cerebral Cortex tissue
Western Blot: LRPAP Antibody [NBP1-89334] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Mouse Cerebral Cortex tissue
Immunocytochemistry/ Immunofluorescence: LRPAP Antibody [NBP1-89334] - Staining of mouse hypothalamus shows distinct positivity in paraventricular and periventricular nuclei.
Immunocytochemistry/ Immunofluorescence: LRPAP Antibody [NBP1-89334] - Staining of mouse lateral septum shows positivity in selected neurons.
Immunocytochemistry/ Immunofluorescence: LRPAP Antibody [NBP1-89334] - Staining of mouse olfactory bulb shows immunoreactivity in the mitral and periglomerular cell layers.
Immunocytochemistry/ Immunofluorescence: LRPAP Antibody [NBP1-89334] - Staining of mouse piriform cortex shows immunoreactivity in neurons.
Immunocytochemistry/ Immunofluorescence: LRPAP Antibody [NBP1-89334] - Staining of mouse somatosensory cortex shows immunoreactivity in neurons.
Immunohistochemistry-Paraffin: LRPAP Antibody [NBP1-89334] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: LRPAP Antibody [NBP1-89334] - Staining of human cerebral cortex shows strong cytoplasmic immunoreactivity in neurons.
Immunohistochemistry-Paraffin: LRPAP Antibody [NBP1-89334] - Staining of human hippocampus shows strong cytoplasmic positivity in neuronal cell bodies.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LRPAP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RMEKLNQLWEKAQRLHLPPVRLAELHADLKIQERDELAWKKLKLDGLDEDGEKEARLIRNLNVILAKYGLDGKKDARQVTSNSLSGTQEDGLDDPRLEKLWHKAKTSGKFSGEELDKLWREFLHHKEK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LRPAP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
LRPAP Protein (NBP1-89334PEP)
Publications
Read Publications using NBP1-89334.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LRPAP Antibody

  • A2MRAP
  • A2MRAPMRAP
  • A2RAP
  • alpha-2-macroglobulin receptor-associated protein 1
  • alpha-2-macroglobulin receptor-associated protein
  • alpha-2-MRAP
  • HBP44
  • lipoprotein receptor associated protein
  • low density lipoprotein receptor-related protein associated protein 1
  • Low density lipoprotein receptor-related protein-associated protein 1
  • low density lipoprotein-related protein-associated protein 1(alpha-2-macroglobulin receptor-associated protein 1)
  • LRPAP
  • LRPAP1
  • MGC138272
  • RAP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52506
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
NBP1-33002
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-33560
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NLS6792
Species: Hu, Mu, Po, Bt, Bv, Ca, Eq, Ha, Mk, Pm, Rb
Applications: IHC-P
NBP2-22526
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
H00010411-D01P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NB100-292
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB110-96417
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-49938
Species: Hu, Mu
Applications: WB, IHC-P, IP
MAB6240
Species: Hu
Applications: WB, IHC
NBP2-24614
Species: Hu, Mu, Rt, Op, Pm
Applications: WB
NB100-55268
Species: Hu
Applications: WB, IP
NBP1-87343
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-77933
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-36999
Species: Hu, Mu, Rt
Applications: PEP-ELISA
NBP2-38621
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24763
Species: Hu, Pm
Applications: WB, IHC-P
NBP1-89334
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for LRPAP Antibody (NBP1-89334)(2)

Reviews for LRPAP Antibody (NBP1-89334) (0)

There are no reviews for LRPAP Antibody (NBP1-89334). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LRPAP Antibody (NBP1-89334) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LRPAP Products

Bioinformatics Tool for LRPAP Antibody (NBP1-89334)

Discover related pathways, diseases and genes to LRPAP Antibody (NBP1-89334). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LRPAP Antibody (NBP1-89334)

Discover more about diseases related to LRPAP Antibody (NBP1-89334).
 

Pathways for LRPAP Antibody (NBP1-89334)

View related products by pathway.

PTMs for LRPAP Antibody (NBP1-89334)

Learn more about PTMs related to LRPAP Antibody (NBP1-89334).

Blogs on LRPAP

There are no specific blogs for LRPAP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LRPAP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LRPAP1
Entrez