RAPH1 Antibody


Immunohistochemistry: RAPH1 Antibody [NBP1-90860] - Staining of human skin shows strong cytoplasmic positivity in epidermal cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

RAPH1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: QLSDEEIDHGAEEDSDKEDQDLDKMFGAWLGELDKLTQSLDSDKPMEPVKRSPLRQETNMANFSYRFSIYNLN
Specificity of human RAPH1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for RAPH1 Antibody

  • candidate 18
  • candidate 9
  • lamellipodin
  • PREL2
  • PREL-2
  • proline rich EVH1 ligand 2
  • Protein RMO1
  • Ras association (RalGDS/AF-6) and pleckstrin homology domains 1
  • ras-associated and pleckstrin homology domains-containing protein 1
  • RMO1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, B/N
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)

Publications for RAPH1 Antibody (NBP1-90860) (0)

There are no publications for RAPH1 Antibody (NBP1-90860).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAPH1 Antibody (NBP1-90860) (0)

There are no reviews for RAPH1 Antibody (NBP1-90860). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RAPH1 Antibody (NBP1-90860) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional RAPH1 Products

Bioinformatics Tool for RAPH1 Antibody (NBP1-90860)

Discover related pathways, diseases and genes to RAPH1 Antibody (NBP1-90860). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAPH1 Antibody (NBP1-90860)

Discover more about diseases related to RAPH1 Antibody (NBP1-90860).

Pathways for RAPH1 Antibody (NBP1-90860)

View related products by pathway.

PTMs for RAPH1 Antibody (NBP1-90860)

Learn more about PTMs related to RAPH1 Antibody (NBP1-90860).

Blogs on RAPH1

There are no specific blogs for RAPH1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RAPH1 Antibody and receive a gift card or discount.


Gene Symbol RAPH1