RIAM/APBB1IP Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: RIAM/APBB1IP Antibody [NBP2-14300] - Immunofluorescent staining of human cell line BJ shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: RIAM/APBB1IP Antibody [NBP2-14300] - Staining of human appendix shows strong cytoplasmic positivity in lymphoid tissues. Epithelial cells in glands are unstained.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RIAM/APBB1IP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MGESSEDIDQMFSTLLGEMDLLTQSLGVDTLPPPDPNPPRAEFNYSVGFK DLNESLNALEDQDLDALMADLVADISEAEQRTIQAQKESLQNQHHSASLQ ASIFSGAASLGYGTNVAATGISQYEDDLPPPPADPVLDLPLPPP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
APBB1IP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RIAM/APBB1IP Protein (NBP2-14300PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%), Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RIAM/APBB1IP Antibody

  • amyloid beta (A4) precursor protein-binding, family B, member 1 interactingprotein
  • amyloid beta A4 precursor protein-binding family B member 1-interacting protein
  • APBB1-interacting protein 1
  • APBB1IP
  • INAG1
  • PREL1
  • PREL-1
  • proline rich EVH1 ligand 1
  • Proline-rich EVH1 ligand 1
  • Proline-rich protein 73
  • Rap1-GTP-interacting adapter molecule
  • Rap1-interacting adaptor molecule
  • RARP1
  • Retinoic acid-responsive proline-rich protein 1
  • RIAM
  • RIAMRARP-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22526
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-292
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-49938
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-00555
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF4264
Species: Hu
Applications: WB
MAB3857
Species: Hu
Applications: WB
NB200-610
Species: Hu, Ca, GP
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP
NB500-328
Species: Hu
Applications: Flow, IP, CyTOF-ready
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-87914
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-248
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1045
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-36768
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89334
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90859
Species: Hu
Applications: IHC, IHC-P
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-14300
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for RIAM/APBB1IP Antibody (NBP2-14300) (0)

There are no publications for RIAM/APBB1IP Antibody (NBP2-14300).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RIAM/APBB1IP Antibody (NBP2-14300) (0)

There are no reviews for RIAM/APBB1IP Antibody (NBP2-14300). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RIAM/APBB1IP Antibody (NBP2-14300) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RIAM/APBB1IP Products

Bioinformatics Tool for RIAM/APBB1IP Antibody (NBP2-14300)

Discover related pathways, diseases and genes to RIAM/APBB1IP Antibody (NBP2-14300). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RIAM/APBB1IP Antibody (NBP2-14300)

Discover more about diseases related to RIAM/APBB1IP Antibody (NBP2-14300).
 

Pathways for RIAM/APBB1IP Antibody (NBP2-14300)

View related products by pathway.

PTMs for RIAM/APBB1IP Antibody (NBP2-14300)

Learn more about PTMs related to RIAM/APBB1IP Antibody (NBP2-14300).

Blogs on RIAM/APBB1IP

There are no specific blogs for RIAM/APBB1IP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RIAM/APBB1IP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol APBB1IP
Entrez