![Immunocytochemistry/Immunofluorescence: RanBP3 Antibody [NBP1-92314] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.](http://images.novusbio.com/fullsize/RanBP3-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-92314-img0004.jpg "Immunocytochemistry/Immunofluorescence: RanBP3 Antibody [NBP1-92314] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit RanBP3 Antibody - BSA Free (NBP1-92314) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LENSTNSADASSNKFVFGQNMSERVLSPPKLNEVSSDANRENAAAESGSESSSQEATPEKESLAESAAAYTKATARKCLLEKVEVITGE |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RANBP3 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Western_Blot_5100.jpg)
![Chromatin Immunoprecipitation (ChIP) beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Chromatin_Immunoprecipitation_11251.jpg)
![Simple Western beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/betaCatenin_AF1329_Simple_Western_17134.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for RanBP3 Antibody (NBP1-92314)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RANBP3 |
![Immunohistochemistry-Paraffin: RanBP3 Antibody [NBP1-92314] - Staining in human testis and pancreas tissues using anti-RANBP3 antibody. Corresponding RANBP3 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/RanBP3-Antibody-Immunohistochemistry-Paraffin-NBP1-92314-img0006.jpg "Immunohistochemistry-Paraffin: RanBP3 Antibody [NBP1-92314] - Staining in human testis and pancreas tissues using anti-RANBP3 antibody. Corresponding RANBP3 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: RanBP3 Antibody [NBP1-92314] - Staining of human testis shows strong nuclear and cytoplasmic positivity.](http://images.novusbio.com/fullsize/RanBP3-Antibody-Immunohistochemistry-Paraffin-NBP1-92314-img0002.jpg "Immunohistochemistry-Paraffin: RanBP3 Antibody [NBP1-92314] - Staining of human testis shows strong nuclear and cytoplasmic positivity.")
![Immunohistochemistry-Paraffin: RanBP3 Antibody [NBP1-92314] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/RanBP3-Antibody-Immunohistochemistry-Paraffin-NBP1-92314-img0005.jpg "Immunohistochemistry-Paraffin: RanBP3 Antibody [NBP1-92314] - Staining of human pancreas shows low expression as expected.")
![Western Blot Smad2/3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Smad3_AF3797_Western_Blot_5347.jpg)
![Chromatin Immunoprecipitation (ChIP) Smad2/3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Smad3_AF3797_Chromatin_Immunoprecipitation_11240.jpg)
![Immunocytochemistry Smad2/3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Smad3_AF3797_Immunocytochemistry_11829.jpg)
![Immunocytochemistry Nestin Antibody (196908) [Unconjugated]](https://images.novusbio.com/images2/Nestin_MAB1259_Immunocytochemistry_6561.jpg)
![Intracellular Staining by Flow Cytometry Nestin Antibody (196908) [Unconjugated]](https://images.novusbio.com/images/antibody/mab1259_human-nestin-mab-clone-196908-intracellular-staining-by-flow-cytometry-24120239959.jpg)
![Western Blot Nestin Antibody (196908) [Unconjugated]](https://images.novusbio.com/images/mab1259_human-nestin-mab-clone-196908-41202410481129.jpg)
![Western Blot SOS2 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOS2_AF6260_Western_Blot_9542.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")