Rad9 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Rad9 Antibody [NBP1-87163] - Staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: Rad9 Antibody [NBP1-87163] - Staining of human stomach shows strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Rad9 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AIFTIKDSLLDGHFVLATLSDTDSHSQDLGSPERHQPVPQLQAHSTPHPDDFANDDIDSYMIAMETTIGNEGSRVLPSISLSPGPQPPKSPGPHSEEEDEAEPSTVPGTPPPKKFRSLFFGSILAPV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RAD9A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Rad9 Protein (NBP1-87163PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Rad9 Antibody

  • cell cycle checkpoint control protein RAD9A
  • DNA repair exonuclease rad9 homolog A
  • EC 3.1.11.2
  • hRAD9
  • RAD9 (S. pombe) homolog
  • RAD9 homolog A (S. pombe)
  • RAD9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24457
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NB100-56320
Species: Hu
Applications: WB
NB100-56546
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-89445
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13266
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-308
Species: Hu
Applications: WB, Func, ICC/IF, IP
NBP2-01020
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PLA
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-03417
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-56585
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-304
Species: Hu, Mu, Rt, Fi, Gt, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO
NBP2-58116
Species: Hu
Applications: ICC/IF
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NB100-217
Species: Hu, Mu
Applications: WB, IP, PLA
NBP1-80695
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
AF2535
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC

Publications for Rad9 Antibody (NBP1-87163) (0)

There are no publications for Rad9 Antibody (NBP1-87163).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Rad9 Antibody (NBP1-87163) (0)

There are no reviews for Rad9 Antibody (NBP1-87163). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Rad9 Antibody (NBP1-87163) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Rad9 Products

Bioinformatics Tool for Rad9 Antibody (NBP1-87163)

Discover related pathways, diseases and genes to Rad9 Antibody (NBP1-87163). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Rad9 Antibody (NBP1-87163)

Discover more about diseases related to Rad9 Antibody (NBP1-87163).
 

Pathways for Rad9 Antibody (NBP1-87163)

View related products by pathway.

PTMs for Rad9 Antibody (NBP1-87163)

Learn more about PTMs related to Rad9 Antibody (NBP1-87163).
 

Research Areas for Rad9 Antibody (NBP1-87163)

Find related products by research area.

Blogs on Rad9

There are no specific blogs for Rad9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Rad9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RAD9A