Recombinant Human PXR/NR1I2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PXR/NR1I2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 279-378 of Human NR1I2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:LHEEEYVLMQAISLFSPDRPGVLQHRVVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPFATPLMQELFGITGS

Protein/Peptide Type
Partial Recombinant Protein
Gene
NR1I2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PXR/NR1I2 Protein

  • BXR
  • NR1I2
  • nuclear receptor subfamily 1 group I member 2
  • nuclear receptor subfamily 1, group I, member 2
  • ONR1
  • Orphan nuclear receptor PAR1
  • Orphan nuclear receptor PXR
  • PAR
  • PAR1
  • PAR2
  • Pregnane X receptor
  • PRR
  • PXR
  • PXRPARq
  • SAR
  • Steroid and xenobiotic receptor
  • SXR
  • SXRBXR

Background

NR1I2 - nuclear receptor subfamily 1, group I, member 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

PP-N4111-00
Species: Hu
Applications: WB, IHC, IP
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-01860
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC
NB120-19347
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IF
NBP1-37003
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP1-88192
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47935
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85016
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-71770
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-80870
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ELISA, IHC, IHC-P
NB400-153
Species: Hu
Applications: WB, ICC/IF
H00009002-M01
Species: Hu
Applications: WB, ELISA
NLS261
Species: Hu
Applications: WB (-), IHC-P, ICC
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-87338
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP1-78028
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, ICC/IF
H00008856-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for PXR/NR1I2 Partial Recombinant Protein (H00008856-Q01) (0)

There are no publications for PXR/NR1I2 Partial Recombinant Protein (H00008856-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PXR/NR1I2 Partial Recombinant Protein (H00008856-Q01) (0)

There are no reviews for PXR/NR1I2 Partial Recombinant Protein (H00008856-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PXR/NR1I2 Partial Recombinant Protein (H00008856-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PXR/NR1I2 Products

Bioinformatics Tool for PXR/NR1I2 Partial Recombinant Protein (H00008856-Q01)

Discover related pathways, diseases and genes to PXR/NR1I2 Partial Recombinant Protein (H00008856-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PXR/NR1I2 Partial Recombinant Protein (H00008856-Q01)

Discover more about diseases related to PXR/NR1I2 Partial Recombinant Protein (H00008856-Q01).
 

Pathways for PXR/NR1I2 Partial Recombinant Protein (H00008856-Q01)

View related products by pathway.

PTMs for PXR/NR1I2 Partial Recombinant Protein (H00008856-Q01)

Learn more about PTMs related to PXR/NR1I2 Partial Recombinant Protein (H00008856-Q01).
 

Research Areas for PXR/NR1I2 Partial Recombinant Protein (H00008856-Q01)

Find related products by research area.

Blogs on PXR/NR1I2

There are no specific blogs for PXR/NR1I2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PXR/NR1I2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NR1I2
Entrez