PXR/NR1I2 Antibody

Images

 
Western Blot: PXR/NR1I2 Antibody [H00008856-B01P] - Analysis of NR1I2 expression in rat liver.
Immunocytochemistry/ Immunofluorescence: PXR/NR1I2 Antibody [H00008856-B01P] - Analysis of purified antibody to NR1I2 on HepG2 cell. (antibody concentration 10 ug/ml)
Western Blot: PXR/NR1I2 Antibody [H00008856-B01P] - Analysis of NR1I2 expression in transfected 293T cell line by NR1I2 polyclonal antibody. Lane 1: NR1I2 transfected lysate(47.74 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PXR/NR1I2 Antibody Summary

Immunogen
NR1I2 (NP_003880.3, 1 a.a. - 434 a.a.) full-length human protein. MEVRPKESWNHADFVHCEDTESVPGKPSVNADEEVGGPQICRVCGDKATGYHFNVMTCEGCKGFFRRAMKRNARLRCPFRKGACEITRKTRRQCQACRLRKCLESGMKKEMIMSDEAVEERRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSSGCELPESLQAPSREEAAKWSQVRKDLCSLKVSLQLRGEDGSVWNYKPPADSGGKEIFSLLPHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKGAAFELCQLRFNTVFNAETGTWECGRLSYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRPGVLQHRVVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPFATPLMQELFGITGS
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
NR1I2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for IF and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PXR/NR1I2 Antibody

  • BXR
  • NR1I2
  • nuclear receptor subfamily 1 group I member 2
  • nuclear receptor subfamily 1, group I, member 2
  • ONR1
  • Orphan nuclear receptor PAR1
  • Orphan nuclear receptor PXR
  • PAR
  • PAR1
  • PAR2
  • Pregnane X receptor
  • PRR
  • PXR
  • PXRPARq
  • SAR
  • Steroid and xenobiotic receptor
  • SXR
  • SXRBXR

Background

This gene product belongs to the nuclear receptor superfamily, members of which are transcription factors characterized by a ligand-binding domain and a DNA-binding domain. The encoded protein is a transcriptional regulator of the cytochrome P450 gene CYP3A4, binding to the response element of the CYP3A4 promoter as a heterodimer with the 9-cis retinoic acid receptor RXR. It is activated by a range of compounds that induce CYP3A4, including dexamethasone and rifampicin. Several alternatively spliced transcripts encoding different isoforms, some of which use non-AUG (CUG) translation initiation codon, have been described for this gene. Additional transcript variants exist, however, they have not been fully characterized. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PP-N4111-00
Species: Hu
Applications: WB, IHC, IP
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-01860
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC
NB120-19347
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IF
NBP1-37003
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP1-88192
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47935
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85016
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-71770
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-46466
Species: Hu
Applications: IHC
NB400-153
Species: Hu
Applications: WB, ICC/IF
H00009002-M01
Species: Hu
Applications: WB, ELISA
NLS261
Species: Hu
Applications: WB (-), IHC-P, ICC
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-87338
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP1-78028
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, ICC/IF
H00008856-B01P
Species: Hu, Rt
Applications: WB, ICC/IF

Publications for PXR/NR1I2 Antibody (H00008856-B01P) (0)

There are no publications for PXR/NR1I2 Antibody (H00008856-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PXR/NR1I2 Antibody (H00008856-B01P) (0)

There are no reviews for PXR/NR1I2 Antibody (H00008856-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PXR/NR1I2 Antibody (H00008856-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PXR/NR1I2 Products

Bioinformatics Tool for PXR/NR1I2 Antibody (H00008856-B01P)

Discover related pathways, diseases and genes to PXR/NR1I2 Antibody (H00008856-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PXR/NR1I2 Antibody (H00008856-B01P)

Discover more about diseases related to PXR/NR1I2 Antibody (H00008856-B01P).
 

Pathways for PXR/NR1I2 Antibody (H00008856-B01P)

View related products by pathway.

PTMs for PXR/NR1I2 Antibody (H00008856-B01P)

Learn more about PTMs related to PXR/NR1I2 Antibody (H00008856-B01P).
 

Research Areas for PXR/NR1I2 Antibody (H00008856-B01P)

Find related products by research area.

Blogs on PXR/NR1I2

There are no specific blogs for PXR/NR1I2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PXR/NR1I2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NR1I2
Entrez
Uniprot