Purine Nucleoside Phosphorylase/PNP Antibody - BSA Free

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: Purine Nucleoside Phosphorylase/PNP Antibody [NBP1-82541] - Staining in human epididymis and testis tissues using anti-PNP antibody. Corresponding PNP RNA-seq ...read more
Orthogonal Strategies: Western Blot: Purine Nucleoside Phosphorylase/PNP Antibody [NBP1-82541] - Analysis in human cell lines HEK293 and SK-MEL-30 using Anti-PNP antibody. Corresponding PNP RNA-seq data are ...read more
Immunocytochemistry/ Immunofluorescence: Purine Nucleoside Phosphorylase/PNP Antibody [NBP1-82541] - Staining of human cell line RPTEC TERT1 shows localization to cytosol. Antibody staining is shown in green.
Western Blot: Purine Nucleoside Phosphorylase/PNP Antibody [NBP1-82541] - Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
Immunohistochemistry-Paraffin: Purine Nucleoside Phosphorylase/PNP Antibody [NBP1-82541] - Staining of human epididymis shows high expression.
Immunohistochemistry-Paraffin: Purine Nucleoside Phosphorylase/PNP Antibody [NBP1-82541] - Staining of human testis shows low expression as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Validated by:
       

Orthogonal Strategies

 

Order Details

View Available Formulations
Catalog# & Formulation Size Price

Purine Nucleoside Phosphorylase/PNP Antibody - BSA Free Summary

Description
Novus Biologicals Rabbit Purine Nucleoside Phosphorylase/PNP Antibody - BSA Free (NBP1-82541) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-Purine Nucleoside Phosphorylase/PNP Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: YTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERGAPHR
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PNP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Purine Nucleoside Phosphorylase/PNP Protein (NBP1-82541PEP)
Publications
Read Publications using
NBP1-82541 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Purine Nucleoside Phosphorylase/PNP Antibody - BSA Free

  • EC 2.4.2.1
  • FLJ94043
  • FLJ97288
  • Inosine phosphorylase
  • MGC117396
  • MGC125915
  • MGC125916
  • NPFLJ97312
  • nucleoside phosphorylase
  • PNP
  • PRO1837
  • PUNP
  • purine nucleoside phosphorylase
  • purine-nucleoside:orthophosphate ribosyltransferase

Background

The enzyme purine nucleoside phosphorylase, together with adenosine deaminase (ADA) serves a key role in purine catabolism. Mutations in either enzyme result in a severe combined immunodeficiency (SCID).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87404
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, KD, WB
AF6240
Species: Hu
Applications: ELISA, IHC, WB
NBP2-48480
Species: Hu
Applications: Flow-CS, Flow, IHC, IHC-Fr,  IHC-P
NBP1-33527
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, Simple Western, WB
NBP2-15291
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-16735
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-89519
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, PLA, WB
NBP1-82485
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-31368
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-87454
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
202-IL
Species: Hu
Applications: BA
NBP1-81838
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP2-16108
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-91705
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NB100-2737
Species: Hu
Applications: ICC/IF, IHC, IP, WB
NBP1-83107
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
H00004507-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
DY1268
Species: Hu
Applications: ELISA
NBP1-82541
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC

Publications for Purine Nucleoside Phosphorylase/PNP Antibody (NBP1-82541)(2)

Reviews for Purine Nucleoside Phosphorylase/PNP Antibody (NBP1-82541) (0)

There are no reviews for Purine Nucleoside Phosphorylase/PNP Antibody (NBP1-82541). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Purine Nucleoside Phosphorylase/PNP Antibody (NBP1-82541) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Purine Nucleoside Phosphorylase/PNP Products

Research Areas for Purine Nucleoside Phosphorylase/PNP Antibody (NBP1-82541)

Find related products by research area.

Blogs on Purine Nucleoside Phosphorylase/PNP

There are no specific blogs for Purine Nucleoside Phosphorylase/PNP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Purine Nucleoside Phosphorylase/PNP Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol PNP