Purine Nucleoside Phosphorylase/PNP Antibody

Images

 
Western Blot: Purine Nucleoside Phosphorylase/PNP Antibody [NBP1-82541] - Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
Immunohistochemistry-Paraffin: Purine Nucleoside Phosphorylase/PNP Antibody [NBP1-82541] - Staining of human epididymis shows strong cytoplasmic positivity in glandular cells.
Western Blot: Purine Nucleoside Phosphorylase/PNP Antibody [NBP1-82541] - Analysis in human cell line U-937 MG.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Purine Nucleoside Phosphorylase/PNP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERGAPHR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PNP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Purine Nucleoside Phosphorylase/PNP Protein (NBP1-82541PEP)
Publications
Read Publication using NBP1-82541.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22068816)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Purine Nucleoside Phosphorylase/PNP Antibody

  • EC 2.4.2.1
  • FLJ94043
  • FLJ97288
  • Inosine phosphorylase
  • MGC117396
  • MGC125915
  • MGC125916
  • NPFLJ97312
  • nucleoside phosphorylase
  • PNP
  • PRO1837
  • PUNP
  • purine nucleoside phosphorylase
  • purine-nucleoside:orthophosphate ribosyltransferase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB6240
Species: Hu
Applications: WB, IHC
NBP1-85740
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33527
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15291
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-935
Species: Bv
Applications: WB, ELISA, IP
NBP1-89519
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82485
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31368
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-43639
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-91705
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-45397
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83107
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00004507-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-52557
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, IF
NBP1-82541
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Purine Nucleoside Phosphorylase/PNP Antibody (NBP1-82541)(1)

Reviews for Purine Nucleoside Phosphorylase/PNP Antibody (NBP1-82541) (0)

There are no reviews for Purine Nucleoside Phosphorylase/PNP Antibody (NBP1-82541). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Purine Nucleoside Phosphorylase/PNP Antibody (NBP1-82541) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Purine Nucleoside Phosphorylase/PNP Products

Bioinformatics Tool for Purine Nucleoside Phosphorylase/PNP Antibody (NBP1-82541)

Discover related pathways, diseases and genes to Purine Nucleoside Phosphorylase/PNP Antibody (NBP1-82541). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Purine Nucleoside Phosphorylase/PNP Antibody (NBP1-82541)

Discover more about diseases related to Purine Nucleoside Phosphorylase/PNP Antibody (NBP1-82541).
 

Pathways for Purine Nucleoside Phosphorylase/PNP Antibody (NBP1-82541)

View related products by pathway.

PTMs for Purine Nucleoside Phosphorylase/PNP Antibody (NBP1-82541)

Learn more about PTMs related to Purine Nucleoside Phosphorylase/PNP Antibody (NBP1-82541).

Blogs on Purine Nucleoside Phosphorylase/PNP

There are no specific blogs for Purine Nucleoside Phosphorylase/PNP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Purine Nucleoside Phosphorylase/PNP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PNP
Entrez