Orthogonal Strategies: Immunohistochemistry-Paraffin: Purine Nucleoside Phosphorylase/PNP Antibody [NBP1-82541] - Staining in human epididymis and testis tissues using anti-PNP antibody. Corresponding PNP RNA-seq ...read more
Orthogonal Strategies: Western Blot: Purine Nucleoside Phosphorylase/PNP Antibody [NBP1-82541] - Analysis in human cell lines HEK293 and SK-MEL-30 using Anti-PNP antibody. Corresponding PNP RNA-seq data are ...read more
Immunocytochemistry/ Immunofluorescence: Purine Nucleoside Phosphorylase/PNP Antibody [NBP1-82541] - Staining of human cell line RPTEC TERT1 shows localization to cytosol. Antibody staining is shown in green.
Western Blot: Purine Nucleoside Phosphorylase/PNP Antibody [NBP1-82541] - Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
Immunohistochemistry-Paraffin: Purine Nucleoside Phosphorylase/PNP Antibody [NBP1-82541] - Staining of human epididymis shows high expression.
Immunohistochemistry-Paraffin: Purine Nucleoside Phosphorylase/PNP Antibody [NBP1-82541] - Staining of human testis shows low expression as expected.
Novus Biologicals Rabbit Purine Nucleoside Phosphorylase/PNP Antibody - BSA Free (NBP1-82541) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-Purine Nucleoside Phosphorylase/PNP Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: YTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERGAPHR
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PNP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
The enzyme purine nucleoside phosphorylase, together with adenosine deaminase (ADA) serves a key role in purine catabolism. Mutations in either enzyme result in a severe combined immunodeficiency (SCID).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Reviews for Purine Nucleoside Phosphorylase/PNP Antibody (NBP1-82541) (0)
There are no reviews for Purine Nucleoside Phosphorylase/PNP Antibody (NBP1-82541).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our Purine Nucleoside Phosphorylase/PNP Antibody - BSA Free and receive a gift card or discount.