MTAP Antibody (2G4)

Western Blot: MTAP Antibody (2G4) [H00004507-M01] - MTAP monoclonal antibody (M01), clone 2G4. Analysis of MTAP expression in NIH/3T3.

Immunocytochemistry/Immunofluorescence: MTAP Antibody (2G4) [H00004507-M01] - Analysis of monoclonal antibody to MTAP on HeLa cell. Antibody concentration 10 ug/ml.

Western Blot: MTAP Antibody (2G4) [H00004507-M01] - MTAP monoclonal antibody (M01), clone 2G4 Analysis of MTAP expression in HeLa.

Western Blot: MTAP Antibody (2G4) [H00004507-M01] - MTAP monoclonal antibody (M01), clone 2G4. Analysis of MTAP expression in PC-12.

Western Blot: MTAP Antibody (2G4) [H00004507-M01] - MTAP monoclonal antibody (M01), clone 2G4. Analysis of MTAP expression in Raw 264.7.

ELISA: MTAP Antibody (2G4) [H00004507-M01] - Detection limit for recombinant GST tagged MTAP is approximately 0.3ng/ml as a capture antibody.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 2G4
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

MTAP Antibody (2G4) Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: MTAP (AAH18625, 1 a.a. ~ 154 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCILLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDSHVRRACFPFTFHHDCFQRPPQKPSRSHCVSCATCRTMS
• Localization: Cytoplasmic
• Specificity: MTAP - methylthioadenosine phosphorylase
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: MTAP
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/Immunofluorescence 1:10-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA. Use in Immunohistochemistry-Paraffin reported in scientific literature (PMID:32284171).

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Mouse-On-Mouse blocking reagent may be needed for IHC and ICC experiments to reduce high background signal. You can find these reagents under catalog numbers PK-2200-NB and MP-2400-NB. Please contact Technical Support if you have any questions.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MTAP Antibody (2G4)

• 5'-methylthioadenosine phosphorylase
• BDMF
• C86fus
• DMSFH
• DMSMFH
• EC 2.4.2.28
• HEL-249
• LGMBF
• methylthioadenosine phosphorylase
• MSAPMeSAdo phosphorylase
• MTA phosphorylase
• MTAP
• MTAPase
• S-methyl-5'-thioadenosine phosphorylase

Background

This gene encodes an enzyme that plays a major role in polyamine metabolism and is important for the salvage of both adenine and methionine. The encoded enzyme is deficient in many cancers because this gene and the tumor suppressor p16 gene are co-deleted. Multiple alternatively spliced transcript variants have been described for this gene, but their full-length natures remain unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MTAP Antibody (H00004507-M01)(25)

Publications using H00004507-M01

• Theoni M, Stefan R, Patric J et al. Evaluation of MTAP and p16 immunohistochemical deficiency as surrogate marker for CDKN2A/B homozygous deletion in gliomas. Pathology. 2023-03-15 [PMID: 37032198]
• Yuki Y, Kenzo H, Hisayuki O et al. Usefulness of malignant pleural effusion for early cytological diagnosis of mesothelioma in situ: A case report. Oncol Lett. 2022-10-25 [PMID: 36420072]
• E. O, E. S, M. D et al. 34th European Congress of Pathology - Abstracts. Virchows Arch. 2022-08-16 [PMID: 35972647]
• Luka B, Nolwenn S, Florian G et al. A Combination of MTAP and p16 Immunohistochemistry Can Substitute for CDKN2A Fluorescence In Situ Hybridization in Diagnosis and Prognosis of Pleural Mesotheliomas Arch Pathol Lab Med. 2022-06-23 [PMID: 35738002]
• Dean F, Amy K, Seid M et al. Abemaciclib in patients with p16ink4A-deficient mesothelioma (MiST2): a single-arm, open-label, phase 2 trial. Lancet Oncol. 2022-02-11 [PMID: 35157829]
• Megumi N, Naoe J, Yugo T et al. Sarcomatoid mesothelioma originating from mesothelioma in situ: are methylthioadenosine phosphorylase loss and CDKN2A homozygous deletion poor prognostic factors for preinvasive mesothelioma? Virchows Arch. 2022-01-19 [PMID: 35043235]
• Shoh S, Maiko T, Takanori H et al. Correlation of MTAP Immunohistochemistry With CDKN2A Status Assessed by Fluorescence In Situ Hybridization and Clinicopathological Features in CNS WHO Grade 2 and 3 Meningiomas: A Single Center Cohort Study. J Neuropathol Exp Neurol. 2021-12-13 [PMID: 34897475]
• Simone T, Anja R, Eunhee Y et al. Loss of Methylthioadenosine Phosphorylase by Immunohistochemistry Is Common in Pulmonary Sarcomatoid Carcinoma and Sarcomatoid Mesothelioma. Am J Clin Pathol. 2021-08-31 [PMID: 34463336]
• Toshiaki K, Reishi S, Kuniharu M et al. Malignant pleural mesothelioma with heterologous elements. J Clin Pathol. 2021-08-10 [PMID: 34376566]
• Taylor S, Andrew C CD146 immunohistochemical staining for the separation of benign from malignant mesothelial proliferations. Virchows Arch. 2021-03-15 [PMID: 33721119]
• Yoshiaki K, Makoto H, Shinji M et al. Fluorescence in situ hybridization detection of chromosome 22 monosomy in pleural effusion cytology for the diagnosis of mesothelioma. Cancer Cytopathol. 2021-01-25 [PMID: 33493384]
• No L Abstracts : 32 nd Congress of the ESP and XXXIII International Congress of the IAP. Virchows Arch. 2020-12-15 [PMID: 33236167]
• Kaishi S, Makoto O, Yuko M et al. Utility of methylthioadenosine phosphorylase immunohistochemical deficiency as a surrogate for CDKN2A homozygous deletion in the assessment of adult-type infiltrating astrocytoma. Mod Pathol. 2020-10-19 [PMID: 33077924]
• He R, Simon C, Andrew C et al. c-MET immunohistochemistry for differentiating malignant mesothelioma from benign mesothelial proliferations. Hum Pathol. 2020-09-08 [PMID: 32916162]
• Yoshiaki K, Makoto H, Shinji M et al. Genomic-based Ancillary Assays Offer Improved Diagnostic Yield of Effusion Cytology With Potential Challenges in Malignant Pleural Mesothelioma. Pathol Int. 2020-06-15 [PMID: 32542810]
• Fujii T, Itami H, Uchiyama T et al. HEG1-responsive microRNA-23b regulates cell proliferation in malignant mesothelioma cells Biochem. Biophys. Res. Commun. 2020-04-10 [PMID: 32284171] (IF/IHC, IHC-P, Human)
• Berg K, Churg A, Cheung S et al. Usefulness of methylthioadenosine phosphorylase and BRCA-associated protein 1 immunohistochemistry in the diagnosis of malignant mesothelioma in effusion cytology specimens. Cancer Cytopathol. 2019-12-10 [PMID: 31821740]
• Minami K, Jimbo N, Tanaka Y et al. Malignant mesothelioma in situ diagnosed by methylthioadenosine phosphorylase loss and homozygous deletion of CDKN2A: a case report. Virchows Arch. 2019-10-30 [PMID: 31667596]
• Konishi M, Kanyama T, Maeno K et al. Detection of Anaplastic Lymphoma Kinase-Rearranged Mesothelioma Cells in Ascites by Companion Diagnostics. Acta Cytol. 2019-10-29 [PMID: 31661685]
• Brich S, Bozzi F, Perrone F et al. Fluorescence in situ hybridization (FISH) provides estimates of minute and interstitial BAP1, CDKN2A, and NF2 gene deletions in peritoneal mesothelioma. Mod Pathol. 2019-09-30 [PMID: 31570769]
• Churg A, Galateau-Salle F, Roden A et al. Malignant mesothelioma in situ: morphologic features and clinical outcome. Mod Pathol. 2019-08-02 [PMID: 31375770]
• Kinoshita Y, Hamasaki M, Yoshimura M et al. Hemizygous loss of NF2 detected by fluorescence in situ hybridization is useful for the diagnosis of malignant pleural mesothelioma. Mod Pathol. 2019-06-23 [PMID: 31231129]
• Chapel D, Schulte J, Berg K et al. MTAP immunohistochemistry is an accurate and reproducible surrogate for CDKN2A fluorescence in situ hybridization in diagnosis of malignant pleural mesothelioma. Mod Pathol. 2019-06-23 [PMID: 31231127]
• Berg KB, Dacic S, Miller C et al. Utility of Methylthioadenosine Phosphorylase Compared With BAP1 Immunohistochemistry, and CDKN2A and NF2 Fluorescence In Situ Hybridization in Separating Reactive Mesothelial Proliferations From Epithelioid Malignant Mesotheliomas. Arch Pathol Lab Med 2018-07-30 [PMID: 30059257]
• Rose AE, Poliseno L, Wang J et al. Integrative genomics identifies molecular alterations that challenge the linear model of melanoma progression. Cancer Res. 2011-02-22 [PMID: 21343389]

Bioinformatics

• Gene Symbol: MTAP
• Entrez:
  • 4507(Human)
• OMIM:
  • 156540(Human)
• Uniprot:
  • AAH18625(Human)