MTAP Antibody (2G4)

Images

 
Western Blot: MTAP Antibody (2G4) [H00004507-M01] - MTAP monoclonal antibody (M01), clone 2G4. Analysis of MTAP expression in NIH/3T3.
Immunocytochemistry/ Immunofluorescence: MTAP Antibody (2G4) [H00004507-M01] - Analysis of monoclonal antibody to MTAP on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: MTAP Antibody (2G4) [H00004507-M01] - MTAP monoclonal antibody (M01), clone 2G4 Analysis of MTAP expression in HeLa.
Western Blot: MTAP Antibody (2G4) [H00004507-M01] - MTAP monoclonal antibody (M01), clone 2G4. Analysis of MTAP expression in PC-12.
Western Blot: MTAP Antibody (2G4) [H00004507-M01] - MTAP monoclonal antibody (M01), clone 2G4. Analysis of MTAP expression in Raw 264.7.
ELISA: MTAP Antibody (2G4) [H00004507-M01] - Detection limit for recombinant GST tagged MTAP is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P
Clone
2G4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MTAP Antibody (2G4) Summary

Immunogen
MTAP (AAH18625, 1 a.a. ~ 154 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCILLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDSHVRRACFPFTFHHDCFQRPPQKPSRSHCVSCATCRTMS
Localization
Cytoplasmic
Specificity
MTAP - methylthioadenosine phosphorylase
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MTAP
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence 1:10-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA. Use in Immunohistochemistry-Paraffin reported in scientific literature (PMID:32284171).
Publications
Read Publications using
H00004507-M01 in the following applications:

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Mouse-On-Mouse blocking reagent may be needed for IHC and ICC experiments to reduce high background signal. You can find these reagents under catalog numbers PK-2200-NB and MP-2400-NB. Please contact Technical Support if you have any questions.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MTAP Antibody (2G4)

  • 5'-methylthioadenosine phosphorylase
  • BDMF
  • C86fus
  • DMSFH
  • DMSMFH
  • EC 2.4.2.28
  • HEL-249
  • LGMBF
  • methylthioadenosine phosphorylase
  • MSAPMeSAdo phosphorylase
  • MTA phosphorylase
  • MTAP
  • MTAPase
  • S-methyl-5'-thioadenosine phosphorylase

Background

This gene encodes an enzyme that plays a major role in polyamine metabolism and is important for the salvage of both adenine and methionine. The encoded enzyme is deficient in many cancers because this gene and the tumor suppressor p16 gene are co-deleted. Multiple alternatively spliced transcript variants have been described for this gene, but their full-length natures remain unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-45603
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP1-82454
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-82541
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00029107-M08
Species: Hu
Applications: ELISA, ICC/IF, KD, S-ELISA, WB
NBP3-15267
Species: Hu, Mu, Rt
Applications: ICC/IF, IP, WB
NBP1-89519
Species: Hu
Applications: ICC/IF, IHC, IHC-P, PLA, WB
NBP2-00776
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-32887
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-75930
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
8499-IF/CF
Species: Hu
Applications: BA
NB100-1793
Species: Hu, Pm, Mu, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
AF231
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NBP2-15291
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00003451-D01P
Species: Hu, Rt
Applications: ICC/IF, WB

Publications for MTAP Antibody (H00004507-M01)(3)

Reviews for MTAP Antibody (H00004507-M01) (0)

There are no reviews for MTAP Antibody (H00004507-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MTAP Antibody (H00004507-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MTAP Products

Bioinformatics Tool for MTAP Antibody (H00004507-M01)

Discover related pathways, diseases and genes to MTAP Antibody (H00004507-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MTAP Antibody (H00004507-M01)

Discover more about diseases related to MTAP Antibody (H00004507-M01).
 

Pathways for MTAP Antibody (H00004507-M01)

View related products by pathway.

PTMs for MTAP Antibody (H00004507-M01)

Learn more about PTMs related to MTAP Antibody (H00004507-M01).

Blogs on MTAP

There are no specific blogs for MTAP, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MTAP Antibody (2G4) and receive a gift card or discount.

Bioinformatics

Gene Symbol MTAP
Entrez
OMIM
Uniprot