IMPA1 Antibody

Images

 
Western Blot: IMPA1 Antibody [NBP1-83107] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: IMPA1 Antibody [NBP1-83107] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & mitochondria.
Immunohistochemistry-Paraffin: IMPA1 Antibody [NBP1-83107] - Staining of human testis shows strong cytoplasmic and nuclear positivity in seminiferous tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IMPA1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:CIPVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IMPA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
IMPA1 Protein (NBP1-83107PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IMPA1 Antibody

  • EC 3.1.3.25
  • IMP 1
  • IMP
  • IMPA
  • IMPase 1
  • inositol monophosphatase 1
  • inositol(myo)-1(or 4)-monophosphatase 1
  • Inositol-1(or 4)-monophosphatase 1
  • Lithium-sensitive myo-inositol monophosphatase A1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85740
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
MAB6240
Species: Hu
Applications: WB, IHC
NBP1-33527
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-90360
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86847
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-38956
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-32276
Species: Hu
Applications: WB, IP
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP1-89192
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15291
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89519
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-22568
Species: Hu
Applications: IHC-P
NB600-935
Species: Bv
Applications: WB, ELISA, IP
AF6486
Species: Hu
Applications: WB, Simple Western
NBP1-83107
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for IMPA1 Antibody (NBP1-83107) (0)

There are no publications for IMPA1 Antibody (NBP1-83107).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IMPA1 Antibody (NBP1-83107) (0)

There are no reviews for IMPA1 Antibody (NBP1-83107). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for IMPA1 Antibody (NBP1-83107) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IMPA1 Products

Bioinformatics Tool for IMPA1 Antibody (NBP1-83107)

Discover related pathways, diseases and genes to IMPA1 Antibody (NBP1-83107). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IMPA1 Antibody (NBP1-83107)

Discover more about diseases related to IMPA1 Antibody (NBP1-83107).
 

Pathways for IMPA1 Antibody (NBP1-83107)

View related products by pathway.

PTMs for IMPA1 Antibody (NBP1-83107)

Learn more about PTMs related to IMPA1 Antibody (NBP1-83107).
 

Research Areas for IMPA1 Antibody (NBP1-83107)

Find related products by research area.

Blogs on IMPA1

There are no specific blogs for IMPA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IMPA1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IMPA1