Reactivity | HuSpecies Glossary |
Applications | WB, ICC/IF, IHC, IHC-P, PLA |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLKATHGGRIDYIAGD |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | APRT |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. Use in PLA reported in secitific publication PMID: 32439803 |
||
Control Peptide |
|
||
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Publication using NBP1-89519 | Applications | Species |
---|---|---|
Doigneaux C, Pedley AM, Mistry IN et al. Hypoxia Drives the Assembly of the Multi-Enzyme Purinosome Complex J. Biol. Chem. May 21 2020 [PMID: 32439803] (PLA, Human) | PLA | Human |
Secondary Antibodies |
Isotype Controls |
Diseases for APRT Antibody (NBP1-89519)Discover more about diseases related to APRT Antibody (NBP1-89519).
| Pathways for APRT Antibody (NBP1-89519)View related products by pathway.
|
PTMs for APRT Antibody (NBP1-89519)Learn more about PTMs related to APRT Antibody (NBP1-89519).
| Research Areas for APRT Antibody (NBP1-89519)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.