APRT Antibody

Images

 
Western Blot: APRT Antibody [NBP1-89519] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-41
Immunocytochemistry/ Immunofluorescence: APRT Antibody [NBP1-89519] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: APRT Antibody [NBP1-89519] - Staining of human kidney shows moderate cytoplasmic positivity in tubule cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, Func, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

APRT Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLKATHGGRIDYIAGD
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
APRT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Proximity Ligation Assay
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. Use in PLA reported in secitific publication PMID: 32439803
Control Peptide
APRT Protein (NBP1-89519PEP)
Publications
Read Publication using
NBP1-89519 in the following applications:

  • PLA
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for APRT Antibody

  • adenine phosphoribosyltransferase
  • AMP diphosphorylase
  • AMP pyrophosphorylase
  • AMP
  • DKFZp686D13177
  • EC 2.4.2.7
  • MGC125856
  • MGC125857
  • MGC129961
  • transphosphoribosidase

Background

Adenine phosphoribosyltransferase belongs to the purine/pyrimidine phosphoribosyltransferase family. A conserved feature of this gene is the distribution of CpG dinucleotides. This enzyme catalyzes the formation of AMP and inorganic pyrophosphate from adenine and 5-phosphoribosyl-1-pyrophosphate (PRPP). It also produces adenine as a by-product of the polyamine biosynthesis pathway. A homozygous deficiency in this enzyme causes 2,8-dihydroxyadenine urolithiasis. Two transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for APRT Antibody (NBP1-89519)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: PLA.


Filter By Application
PLA
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for APRT Antibody (NBP1-89519) (0)

There are no reviews for APRT Antibody (NBP1-89519). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for APRT Antibody (NBP1-89519) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional APRT Products

Research Areas for APRT Antibody (NBP1-89519)

Find related products by research area.

Blogs on APRT

There are no specific blogs for APRT, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our APRT Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol APRT
Entrez
Uniprot