APRT Antibody


Western Blot: APRT Antibody [NBP1-89519] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-41
Immunocytochemistry/ Immunofluorescence: APRT Antibody [NBP1-89519] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: APRT Antibody [NBP1-89519] - Staining of human kidney shows moderate cytoplasmic positivity in tubule cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, PLA

Order Details

APRT Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: MADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLKATHGGRIDYIAGD
Specificity of human APRT antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Proximity Ligation Assay
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. Use in PLA reported in secitific publication PMID: 32439803
APRT Knockout 293T Cell Lysate
Control Peptide
APRT Protein (NBP1-89519PEP)
Read Publication using
NBP1-89519 in the following applications:

  • PLA
    1 publication

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for APRT Antibody

  • adenine phosphoribosyltransferase
  • AMP diphosphorylase
  • AMP pyrophosphorylase
  • AMP
  • DKFZp686D13177
  • EC
  • MGC125856
  • MGC125857
  • MGC129961
  • transphosphoribosidase


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt, Ye
Applications: WB, ELISA, ICC/IF, S-ELISA
Species: Hu, Rt, ChHa
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PLA

Publications for APRT Antibody (NBP1-89519)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: PLA.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for APRT Antibody (NBP1-89519) (0)

There are no reviews for APRT Antibody (NBP1-89519). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for APRT Antibody (NBP1-89519) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional APRT Products

Bioinformatics Tool for APRT Antibody (NBP1-89519)

Discover related pathways, diseases and genes to APRT Antibody (NBP1-89519). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for APRT Antibody (NBP1-89519)

Discover more about diseases related to APRT Antibody (NBP1-89519).

Pathways for APRT Antibody (NBP1-89519)

View related products by pathway.

PTMs for APRT Antibody (NBP1-89519)

Learn more about PTMs related to APRT Antibody (NBP1-89519).

Research Areas for APRT Antibody (NBP1-89519)

Find related products by research area.

Blogs on APRT

There are no specific blogs for APRT, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our APRT Antibody and receive a gift card or discount.


Gene Symbol APRT