BRAP Antibody

Images

 
Western Blot: BRAP Antibody [NBP1-91705] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: BRAP Antibody [NBP1-91705] - Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear membrane & cytosol.
Immunohistochemistry-Paraffin: BRAP Antibody [NBP1-91705] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
Western Blot: BRAP Antibody [NBP1-91705] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: BRAP Antibody [NBP1-91705] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.
Immunohistochemistry-Paraffin: BRAP Antibody [NBP1-91705] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: BRAP Antibody [NBP1-91705] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: BRAP Antibody [NBP1-91705] - Staining of human Fallopian tube shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BRAP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SLVVIRLELAEHSPVPAGFGFSAAAGEMSDEEIKKTTLASAVACLEGKSPGEKVAIIHQHLGRREMTDVIIETMKSNPDELKTTVEERKSSEA
Specificity
Specificity of human, mouse, rat BRAP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BRAP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
BRAP Protein (NBP1-91705PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BRAP Antibody

  • BRAP2RING finger protein 52
  • BRCA1 associated protein
  • EC 6.3.2.-
  • IMPBRCA1-associated protein
  • Impedes mitogenic signal propagation
  • Renal carcinoma antigen NY-REN-63
  • RNF52galectin-2-binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85740
Species: Hu, Po
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF6240
Species: Hu
Applications: WB, ELISA, IHC
NBP1-33527
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Eq
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, KD
NB100-404
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, KD
NBP1-86847
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-38956
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
H00081502-P01
Species: Hu
Applications: WB
NBP2-58917
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86616
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89192
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-15291
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89519
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PLA
NBP2-75717
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for BRAP Antibody (NBP1-91705) (0)

There are no publications for BRAP Antibody (NBP1-91705).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BRAP Antibody (NBP1-91705) (0)

There are no reviews for BRAP Antibody (NBP1-91705). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for BRAP Antibody (NBP1-91705) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional BRAP Products

Bioinformatics Tool for BRAP Antibody (NBP1-91705)

Discover related pathways, diseases and genes to BRAP Antibody (NBP1-91705). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BRAP Antibody (NBP1-91705)

Discover more about diseases related to BRAP Antibody (NBP1-91705).
 

Pathways for BRAP Antibody (NBP1-91705)

View related products by pathway.

PTMs for BRAP Antibody (NBP1-91705)

Learn more about PTMs related to BRAP Antibody (NBP1-91705).
 

Research Areas for BRAP Antibody (NBP1-91705)

Find related products by research area.

Blogs on BRAP

There are no specific blogs for BRAP, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BRAP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BRAP