We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

PTEN Antibody - BSA Free

Images

 
Analysis in human cell line A-431.
Staining of human cell line MCF7 shows localization to nucleoplasm.
Analysis in human plasma.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

PTEN Antibody - BSA Free Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAAIHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRT
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PTEN
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for PTEN Antibody - BSA Free

  • BZS
  • EC 3.1.3.16,10q23del
  • EC 3.1.3.48
  • EC 3.1.3.67
  • GLM2
  • MMAC1 phosphatase and tensin homolog deleted on chromosome 10
  • MMAC1
  • MMAC1MGC11227
  • Mutated in multiple advanced cancers 1
  • phosphatase and tensin homologDEC
  • phosphatidylinositol-34,5-trisphosphate 3-phosphatase and dual-specificityprotein phosphatase PTEN
  • PTEN
  • PTEN1
  • TEP1MHAM

Background

PTEN is a protein tyrosine phosphatase that acts as a tumor suppressor, as a lipid phosphatase that dephosphorylates the D3 position of phosphatidylinositol 3,4,5-trisphosphate and as an antagonist of the PI3k/AKT signaling pathway (1-3). PTEN structural domains includes an N-terminal phosphatase domain, a lipid binding C2 domain and a 50-amino acid C-terminal tail that contains a PD biding sequence (5). Phosporylation of the tail of the protein will suppress its activity and modify its conformation to a

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP3-35070
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-15071
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NBP2-46404
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
MAB6210
Species: Hu
Applications: Simple Western, WB
1129-ER
Species: Hu
Applications: BA
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
DVE00
Species: Hu
Applications: ELISA
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
H00003845-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
NBP2-32840
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-89942
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, Simple Western, WB
NBP1-90949
Species: Hu
Applications: IHC,  IHC-P, WB
NBP3-21254
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for PTEN Antibody (NBP3-21254) (0)

There are no publications for PTEN Antibody (NBP3-21254).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PTEN Antibody (NBP3-21254) (0)

There are no reviews for PTEN Antibody (NBP3-21254). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PTEN Antibody (NBP3-21254) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PTEN Products

Research Areas for PTEN Antibody (NBP3-21254)

Find related products by research area.

Blogs on PTEN.

Autophagy Research Update: What a difference a year makes!
By Christina Towers, PhD Over the last two decades the field of autophagy has exploded! Innovative techniques, comprehensive analysis and disease-relevant models have yielded basic and clinical discoveries of conseque...  Read full blog post.

Neurovascular signaling for repair enhances brain metastasis
By Jamshed Arslan, Pharm. D., PhD. Stroke    is a leading cause of mortality and morbidity worldwide. Cellular players – neurons, astrocytes, endothelial and stromal cells – involved in post-stroke repair t...  Read full blog post.

Developmental regulator Daam2 promotes glial cell tumors by degrading Von Hippel-Lindau protein
By Jamshed Arslan Pharm.D. Glioblastoma is an aggressive type of cancer that forms from the star-shaped glial cells of the central nervous system, called astrocytes. Intriguingly, several genes linked to glioblasto...  Read full blog post.

The effects of curcumin on IKB Alpha and the NFkB signaling pathway
The IKK complex, or inhibitor of NFkB kinase, is composed of IKK alpha and IKK beta.  These kinases are at the core of the NFkB signaling cascade.  The NFkB family is made up of transcription factors that are kept inactive in the cytoplasm through...  Read full blog post.

Carbonic anhydrase IX (CAIX) - a reliable histochemical marker of hypoxia
Carbonic anhydrase IX is a member of the carbonic anhydrase family. This family consists of catalytic enzymes capable of converting carbon dioxide and water into carbonic acid, protons, and bicarbonate ions. This family of molecules is abundantly e...  Read full blog post.

CAIX - One of the Best Cellular Markers of Hypoxia
The protein, carbonic anhydrase IX, belongs to the carbonic anhydrase family which consists of enzymes that rapidly convert carbon dioxide and water into the end products of carbonic acid, protons, and bicarbonate ions. These enzymes play a widespread...  Read full blog post.

Getting SHIP-shape Over Tumour Suppression
PTEN antibodies have shown PTEN to be an important tumor suppressor and, in mutated form, a factor in cancer development. However, a recent study, led by Robert Rickert, shows that the SHIP gene may also be an important tumor suppressor in B-cell lymp...  Read full blog post.

PTEN Antibodies and Cancer Research
Phosphatase and tensin homologue (PTEN) antibodies are important tools for cancer research. PTEN is an important tumor suppressor but, in mutated form, is also expressed in a high number of cancers. We at Novus Biologicals have a wide PTEN antibody da...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PTEN Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol PTEN