B-Raf Antibody

Images

 
Western Blot: B-Raf Antibody [NBP1-89942] - Analysis in human cell line MOLT-4.
Immunohistochemistry-Paraffin: B-Raf Antibody [NBP1-89942] - Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in distal tubules.
Western Blot: B-Raf Antibody [NBP1-89942] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: B-Raf Antibody [NBP1-89942] - Immunohistochemical staining of human colorectal cancer shows moderate cytoplasmic positivity in tumor cells.
Immunohistochemistry-Paraffin: B-Raf Antibody [NBP1-89942] - Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: B-Raf Antibody [NBP1-89942] - Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
Simple Western: B-Raf Antibody [NBP1-89942] - Simple Western lane view shows a specific band for BRAF in 0.2 mg/ml of RT-4 (left) and U-251MG sp (right) lysate. This experiment was performed under reducing conditions ...read more
Simple Western: B-Raf Antibody [NBP1-89942] - Electropherogram image(s) of corresponding Simple Western lane view. B-Raf antibody was used at 1:20 dilution on RT-4 and U-251MG sp lysates(s).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

B-Raf Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PIPQEEASLAETALTSGSSPSAPASDSIGPQILTSPSPSKSIPIPQPFRPADEDHRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRMKTLGRRDSS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BRAF
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Simple Western 1:20
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Control Peptide
B-Raf Protein (NBP1-89942PEP)
Publications
Read Publication using
NBP1-89942 in the following applications:

  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 26612112).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for B-Raf Antibody

  • 94 kDa B-raf protein
  • B-Raf proto-oncogene serine/threonine-protein kinase (p94)
  • BRaf
  • B-Raf
  • BRAF1
  • B-RAF1
  • BRAF1MGC126806
  • EC 2.7.11.1
  • MGC138284
  • murine sarcoma viral (v-raf) oncogene homolog B1
  • NS7
  • p94
  • Proto-oncogene B-Raf
  • RAFB1
  • serine/threonine-protein kinase B-raf
  • v-raf murine sarcoma viral oncogene homolog B1FLJ95109

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
AF482
Species: Mu
Applications: WB, IHC
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-46403
Species: Hu
Applications: IHC
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-94887
Species: Hu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-47945
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-33415
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45745
Species: Hu
Applications: WB, IHC, IF
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33581
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-33404
Species: Hu
Applications: IHC, IHC-P
NBP2-43792
Species: Hu
Applications: WB
NBP1-89942
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P

Publications for B-Raf Antibody (NBP1-89942)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for B-Raf Antibody (NBP1-89942) (0)

There are no reviews for B-Raf Antibody (NBP1-89942). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for B-Raf Antibody (NBP1-89942) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional B-Raf Products

Bioinformatics Tool for B-Raf Antibody (NBP1-89942)

Discover related pathways, diseases and genes to B-Raf Antibody (NBP1-89942). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for B-Raf Antibody (NBP1-89942)

Discover more about diseases related to B-Raf Antibody (NBP1-89942).
 

Pathways for B-Raf Antibody (NBP1-89942)

View related products by pathway.

PTMs for B-Raf Antibody (NBP1-89942)

Learn more about PTMs related to B-Raf Antibody (NBP1-89942).
 

Research Areas for B-Raf Antibody (NBP1-89942)

Find related products by research area.

Blogs on B-Raf.

MAPK3/ERK1 - A signal transduction pathway with roles in development and disease
Mitogen-activated protein kinases (MAPKs) are important signaling proteins needed to transmit and relay extracellular stimuli and to illicit intracellular responses (1). The MAPK family of proteins are serine/threonine kinases that are able to phos...  Read full blog post.

You can't be without me - SNF5
The protein encoded by SNF5 is a component of the chromatin-remodeling protein complex responsible for relieving repressive chromatin structures by allowing the transcriptional machinery to access targets more effectively. SNF5 has been found to be a...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our B-Raf Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BRAF
Entrez