PRG2 Antibody


Western Blot: PRG2 Antibody [NBP1-88573] - Analysis in control (vector only transfected HEK293T lysate) and pRG2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: PRG2 Antibody [NBP1-88573] - Staining of human skeletal muscle shows no cytoplasmic positivity as expected.
Immunohistochemistry-Paraffin: PRG2 Antibody [NBP1-88573] - Staining of human placenta shows moderate to strong cytoplasmic positivity in extra villous trophoblast.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

PRG2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: GSGSEDASKKDGAVESISVPDMVDKNLTCPEEEDTVKVVGIPGCQTCRYLLVRSLQTFSQAWFTCRRC
Specificity of human PRG2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Read Publication using NBP1-88573.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PRG2 Antibody

  • BMPG
  • BMPGeosinophil major basic protein
  • bone marrow proteoglycan
  • bone-marrow proteoglycan
  • EMBP
  • MBP1
  • MBP-1
  • MBPeosinophil granule major basic protein
  • MGC14537
  • natural killer cell activator
  • PRG2
  • proteoglycan 2 preproprotein
  • Proteoglycan 2
  • proteoglycan 2, bone marrow (natural killer cell activator, eosinophil granulemajor basic protein)


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Rt
Applications: WB
Species: Hu, Mu, Rt, Bv, Ca, Eq, Gt, GP, Rb
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P

Publications for PRG2 Antibody (NBP1-88573)(1)

Reviews for PRG2 Antibody (NBP1-88573) (0)

There are no reviews for PRG2 Antibody (NBP1-88573). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PRG2 Antibody (NBP1-88573) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional PRG2 Products

Bioinformatics Tool for PRG2 Antibody (NBP1-88573)

Discover related pathways, diseases and genes to PRG2 Antibody (NBP1-88573). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRG2 Antibody (NBP1-88573)

Discover more about diseases related to PRG2 Antibody (NBP1-88573).

Pathways for PRG2 Antibody (NBP1-88573)

View related products by pathway.

PTMs for PRG2 Antibody (NBP1-88573)

Learn more about PTMs related to PRG2 Antibody (NBP1-88573).

Research Areas for PRG2 Antibody (NBP1-88573)

Find related products by research area.

Blogs on PRG2

There are no specific blogs for PRG2, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PRG2 Antibody and receive a gift card or discount.


Gene Symbol PRG2