CNPase Antibody (CL2887)

Western Blot: CNPase Antibody (CL2887) [NBP2-46617] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Mouse Cerebral Cortex tissue

Immunocytochemistry/Immunofluorescence: CNPase Antibody (CL2887) [NBP2-46617] - Staining of RH-30 cells using the Anti-CNP monoclonal antibody, showing specific staining in the cytosol in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available). Antibody staining is shown in green.

Immunohistochemistry-Paraffin: CNPase Antibody (CL2887) [NBP2-46617] - Staining of human pancreas shows absence of immunoreactivity (negative control).

Western Blot: CNPase Antibody (CL2887) [NBP2-46617] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Human Cerebral Cortex tissue

Immunohistochemistry: CNPase Antibody (CL2887) [NBP2-46617] - Staining of rat cerebral cortex shows strong immunoreactivity in single oligodendrocytes.

Immunohistochemistry: CNPase Antibody (CL2887) [NBP2-46617] - Staining of mouse cerebral cortex shows strong immunoreactivity in oligodendrocytes.

Immunohistochemistry-Paraffin: CNPase Antibody (CL2887) [NBP2-46617] - Staining of human cerebral cortex shows strong immunoreactivity in oligodendrocytes.

Immunohistochemistry: CNPase Antibody (CL2887) [NBP2-46617] - Staining of rat hippocampal formation shows strong immunoreactivity in oligodendrocytes and myelinated fibers.

Immunohistochemistry: CNPase Antibody (CL2887) [NBP2-46617] - Staining of mouse amygdala shows strong immunoreactivity in oligodendrocytes.

Immunohistochemistry-Paraffin: CNPase Antibody (CL2887) [NBP2-46617] - Staining of human cerebellum shows strong immunoreactivity in oligodendrocytes and myelinated neural fibers.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clone: CL2887
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

CNPase Antibody (CL2887) Summary

• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence PGVLHCTTKFCDYGKAPGAEEYAQQDVLKKSYSKAFTLTISALFVTPKTTGARVELSEQQLQLWPSDVDKLSPTDNLPRGSRAHITL
• Epitope: LSEQQLQLWPSDVDK
• Isotype: IgG2b
• Clonality: Monoclonal
• Host: Mouse
• Gene: CNP
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 2-10 ug/ml
  • Immunohistochemistry 1:5000 - 1:10000
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
  • Western Blot 1 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Mouse-On-Mouse blocking reagent may be needed for IHC and ICC experiments to reduce high background signal. You can find these reagents under catalog numbers PK-2200-NB and MP-2400-NB. Please contact Technical Support if you have any questions

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Protein A purified

Alternate Names for CNPase Antibody (CL2887)

• 2', 3' cyclic nucleotide 3' phosphohydrolase
• 2'-3'-cyclic nucleotide 3' phosphodiesterase
• 2'-3'-cyclic-nucleotide 3'-phosphodiesterase
• CNP1
• CNPase
• EC 3.1.4.37

Background

2,3-cyclic nucleotide-3-phosphodiesterase (CNP) is a membrane bound, microtubule associated protein that is among the most abundant myelin proteins of the CNS. It is thought that CNP may serve as a regulator of tubulin polymerization and of microtubule distribution (Bifulco et al., 2002). It was recently found that CNP may also function as a possible linker protein anchoring microtubules to the plasma membrane via a 13 residue C-terminal CNP fragment (Bifulco et al., 2002, Esposito et al., 2008).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CNPase Antibody (NBP2-46617)(1)

Publication using NBP2-46617

• Nagree MS, Rybova J, Kleynerman A et al. Spinal muscular atrophy-like phenotype in a mouse model of acid ceramidase deficiency Communications biology 2023-05-25 [PMID: 37231125] (IHC-P, Mouse)
  
  Details:
  1:300 IHC-P dilution

Bioinformatics

• Gene Symbol: CNP
• Entrez:
  • 1267(Human)
• Uniprot:
  • P09543(Human)