CNPase Antibody (CL2887)

Images

 
Western Blot: CNPase Antibody (CL2887) [NBP2-46617] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Mouse Cerebral Cortex tissue
Immunocytochemistry/ Immunofluorescence: CNPase Antibody (CL2887) [NBP2-46617] - Staining of RH-30 cells using the Anti-CNP monoclonal antibody, showing specific staining in the cytosol in green. Microtubule- and ...read more
Immunohistochemistry-Paraffin: CNPase Antibody (CL2887) [NBP2-46617] - Staining of human pancreas shows absence of immunoreactivity (negative control).
Western Blot: CNPase Antibody (CL2887) [NBP2-46617] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Human Cerebral Cortex tissue
Immunohistochemistry: CNPase Antibody (CL2887) [NBP2-46617] - Staining of rat cerebral cortex shows strong immunoreactivity in single oligodendrocytes.
Immunohistochemistry: CNPase Antibody (CL2887) [NBP2-46617] - Staining of mouse cerebral cortex shows strong immunoreactivity in oligodendrocytes.
Immunohistochemistry-Paraffin: CNPase Antibody (CL2887) [NBP2-46617] - Staining of human cerebral cortex shows strong immunoreactivity in oligodendrocytes.
Immunohistochemistry: CNPase Antibody (CL2887) [NBP2-46617] - Staining of rat hippocampal formation shows strong immunoreactivity in oligodendrocytes and myelinated fibers.
Immunohistochemistry: CNPase Antibody (CL2887) [NBP2-46617] - Staining of mouse amygdala shows strong immunoreactivity in oligodendrocytes.
Immunohistochemistry-Paraffin: CNPase Antibody (CL2887) [NBP2-46617] - Staining of human cerebellum shows strong immunoreactivity in oligodendrocytes and myelinated neural fibers.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clone
CL2887
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CNPase Antibody (CL2887) Summary

Immunogen
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence PGVLHCTTKFCDYGKAPGAEEYAQQDVLKKSYSKAFTLTISALFVTPKTTGARVELSEQQLQLWPSDVDKLSPTDNLPRGSRAHITL
Epitope
LSEQQLQLWPSDVDK
Isotype
IgG2b
Clonality
Monoclonal
Host
Mouse
Gene
CNP
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 2-10 ug/ml
  • Immunohistochemistry 1:5000 - 1:10000
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
  • Western Blot 1 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Mouse-On-Mouse blocking reagent may be needed for IHC and ICC experiments to reduce high background signal. You can find these reagents under catalog numbers PK-2200-NB and MP-2400-NB. Please contact Technical Support if you have any questions

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for CNPase Antibody (CL2887)

  • 2', 3' cyclic nucleotide 3' phosphohydrolase
  • 2'-3'-cyclic nucleotide 3' phosphodiesterase
  • 2'-3'-cyclic-nucleotide 3'-phosphodiesterase
  • CNP1
  • CNPase
  • EC 3.1.4.37

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14873
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB600-717
Species: Bv, Ca, Ch, Fe, Gp, Hu, Ma, Mu, Po, Rb, Rt, Sh
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI, WB
NBP2-46201
Species: Hu
Applications: IHC, IHC-P, WB
NBP3-12239
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP1-31333
Species: Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF2307
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
NBP3-04784
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
538-MG
Species: Rt
Applications: BA
NBP1-31365
Species: Ch, Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-87781
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-35224
Species: Hu
Applications: Func, PAGE
NB110-41404
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
AF5724
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP2-93574
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00004340-B01P
Species: Hu, Rt
Applications: WB

Publications for CNPase Antibody (NBP2-46617) (0)

There are no publications for CNPase Antibody (NBP2-46617).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CNPase Antibody (NBP2-46617) (0)

There are no reviews for CNPase Antibody (NBP2-46617). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CNPase Antibody (NBP2-46617) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CNPase Products

Bioinformatics Tool for CNPase Antibody (NBP2-46617)

Discover related pathways, diseases and genes to CNPase Antibody (NBP2-46617). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CNPase Antibody (NBP2-46617)

Discover more about diseases related to CNPase Antibody (NBP2-46617).
 

Pathways for CNPase Antibody (NBP2-46617)

View related products by pathway.

PTMs for CNPase Antibody (NBP2-46617)

Learn more about PTMs related to CNPase Antibody (NBP2-46617).
 

Research Areas for CNPase Antibody (NBP2-46617)

Find related products by research area.

Blogs on CNPase

There are no specific blogs for CNPase, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CNPase Antibody (CL2887) and receive a gift card or discount.

Bioinformatics

Gene Symbol CNP
Entrez
Uniprot