PREB Antibody - Azide and BSA Free Summary
| Description |
Novus Biologicals Rabbit PREB Antibody - Azide and BSA Free (NBP3-04673) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 13-202 of human PREB (NP_037520.1). PFPLYALQVDPSTGLLIAAGGGGAAKTGIKNGVHFLQLELINGRLSASLLHSHDTETRATMNLALAGDILAAGQDAHCQLLRFQAHQQQGNKAEKAGSKEQGPRQRKGAAPAEKKCGAETQHEGLELRVENLQAVQTDFSSDPLQKVVCFNHDNTLLATGGTDGYVRVWKVPSLEKVLEFKAHEGEIEDL |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PREB |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:500-1:2000
|
| Theoretical MW |
45 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.01% Thimerosal |
| Purity |
Affinity purified |
Alternate Names for PREB Antibody - Azide and BSA Free
Background
Prolactin (PRL) expression in the pituitary is limited to specific cells. Pit-1 is a pituitary specific transcription factor that plays an important role in PRL expression, both in mature organism and during development. The PRL promoter contains numerous Pit-1 binding sites and these sites have been implicated in both basal level and kinase-mediated gene expression. The most proximal of these binding sites, termed 1P, has been shown to direct a response to numerous signals, such as cAMP and various G-proteins. A novel protein, termed PREB (prolactin regulatory element binding protein), has been recently identified that regulates PRL gene expression through the 1P site, though it contains no discernable DNA-binding motif. Recent studies suggest that PREB is encoded by a single-copy gene in both mice and humans and exhibits nuclear accumulation in pituitary cells. Evidence suggests that PREB is a novel transcription factor that assists in PRL expression whether alone, or in concert with Pit-1.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, KD, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, S-ELISA, WB
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IP, WB
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Pm
Applications: ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: BA
Species: Ca, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Pm, Mu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Ca, Ch, ChHa, Eq, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, ChIP, ChIP, Dual ISH-IHC, ELISA, Flow, GS, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, PCR, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for PREB Antibody (NBP3-04673) (0)
There are no publications for PREB Antibody (NBP3-04673).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PREB Antibody (NBP3-04673) (0)
There are no reviews for PREB Antibody (NBP3-04673).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PREB Antibody (NBP3-04673) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PREB Products
Research Areas for PREB Antibody (NBP3-04673)
Find related products by research area.
|
Blogs on PREB