VTI1B Antibody

Images

 
Western Blot: VTI1B Antibody [NBP2-33414] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: VTI1B Antibody [NBP2-33414] - Immunofluorescent staining of human cell line U-2 OS shows localization to the Golgi apparatus & vesicles.
Immunohistochemistry-Paraffin: VTI1B Antibody [NBP2-33414] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

VTI1B Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ASSEHFEKLHEIFRGLHEDLQGVPERLLGTAGTEEKKKLIRDFDEKQQEANETLAEMEEELRYAPLSFRNPMMSKLRNYRKDLAKLHREVRSTPLTATPGGR
Specificity
Specificity of human VTI1B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
VTI1B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Positive Control
VTI1B Lysate (NBP2-65200)
Control Peptide
VTI1B Protein (NBP2-33414PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for VTI1B Antibody

  • vesicle transport through interaction with t-SNAREs homolog 1B (yeast)
  • Vesicle transport v-SNARE protein Vti1-like 1
  • vesicle-associated soluble NSF attachment protein receptor
  • v-SNARE
  • VTI1
  • VTI1L
  • VTI1L1
  • VTI1-LIKE
  • Vti1-rp1
  • VTI2vesicle transport through interaction with t-SNAREs homolog 1B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88769
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-87035
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-595
Species: Mu, Rt, Bv, Pm
Applications: WB, Flow, IHC, IHC-P, IP, IF
NB300-510
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF
MAB6117
Species: Hu
Applications: WB, IHC
AF5354
Species: Hu
Applications: WB, IHC
NBP1-83162
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NBP1-87374
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00009685-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-87497
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF5687
Species: Hu, Rt
Applications: WB, Simple Western, IHC, ICC
AF5448
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-45413
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC
NBP1-86101
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-87439
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-33414
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for VTI1B Antibody (NBP2-33414) (0)

There are no publications for VTI1B Antibody (NBP2-33414).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VTI1B Antibody (NBP2-33414) (0)

There are no reviews for VTI1B Antibody (NBP2-33414). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for VTI1B Antibody (NBP2-33414) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for VTI1B Antibody (NBP2-33414)

Discover related pathways, diseases and genes to VTI1B Antibody (NBP2-33414). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VTI1B Antibody (NBP2-33414)

Discover more about diseases related to VTI1B Antibody (NBP2-33414).
 

Pathways for VTI1B Antibody (NBP2-33414)

View related products by pathway.

PTMs for VTI1B Antibody (NBP2-33414)

Learn more about PTMs related to VTI1B Antibody (NBP2-33414).

Blogs on VTI1B

There are no specific blogs for VTI1B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VTI1B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol VTI1B
Uniprot