Home » Pit1 » Pit1 Antibodies » Pit1 Antibody

Pit1 Antibody

 (15 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: Pit1 Antibody [NBP1-92273] - Staining of human liver, pancreas, pituitary gland and tonsil using Anti-POU1F1 antibody NBP1-92273 (A) shows similar protein distribution across tissues to independent antibody NBP2-55357 (B).
Independent Antibodies: Immunohistochemistry-Paraffin: Pit1 Antibody [NBP1-92273] - Staining of human liver, pancreas, pituitary gland and tonsil using Anti-POU1F1 antibody NBP1-92273 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: Pit1 Antibody [NBP1-92273] - Staining of human pituitary gland shows moderate to strong nuclear positivity in neuroendocrine cells in the anterior lobe.
Immunohistochemistry-Paraffin: Pit1 Antibody [NBP1-92273] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Pit1 Antibody [NBP1-92273] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.
Immunohistochemistry-Paraffin: Pit1 Antibody [NBP1-92273] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

        

Order Details

100% Guarantee on every product

Pit1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: CKLKAILSKWLEEAEQVGALYNEKVGANERKRKRRTTISIAAKDALERHFGEQNKPSSQEIMRMAE
Predicted Species
Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
POU1F1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
IHC-P, Retrieval method: HIER pH6
Control Peptide
Pit1 Protein (NBP1-92273PEP)
Publications
Read Publications using
NBP1-92273 in the following applications:

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID:32958754)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Pit1 Antibody

  • CPHD1
  • GHF1
  • GHF-1pituitary-specific positive transcription factor 1
  • Growth hormone factor 1
  • Pit-1
  • PIT1pituitary-specific transcription factor 1
  • POU class 1 homeobox 1
  • POU domain class 1, transcription factor 1
  • POU domain, class 1, transcription factor 1
  • POU1F1a

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Prolactin Antibody
[Unconjugated]
AF682
Recombinant Human Prolactin (Catalog # 682-PL) stimulates proliferation in the Nb2‑11 rat lymphoma cell line in a dose-dependent manner (orange line). Proliferation elicited by Recombinant Human Prolactin (0.5 ng/mL) is neutralized (green line) by increasing concentrations of Goat Anti-Human Prolactin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF682). The ND50 is typically 0.02-0.05 µg/mL.
Prolactin was detected in immersion fixed paraffin-embedded sections of human testis using Goat Anti-Human Prolactin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF682) at 1 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm of sperm cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Western blot shows lysates of human pituitary tissue. PVDF membrane was probed with 0.25 µg/mL of Goat Anti-Human Prolactin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF682) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Prolactin at approximately 23 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(6 Publications)
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, WB
Growth Hormone
Antibody [Unconjugate
AF1067
Western blot shows lysates of human, mouse, and rat pituitary gland tissue. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human Growth Hormone Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1067) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Growth Hormone at approximately 22 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Recombinant Human Growth Hormone protein was serially diluted 2-fold and captured by Mouse Anti-Human Growth Hormone Monoclonal Antibody (Catalog # MAB10671) coated on a Clear Polystyrene Microplate (Catalog # DY990). Goat Anti-Human/Mouse/Rat Growth Hormone Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1067) was biotinylated and incubated with the protein captured on the plate. Detection of the standard curve was achieved by incubating Streptavidin-HRP (Catalog # DY998) followed by Substrate Solution (Catalog # DY999) and stopping the enzymatic reaction with Stop Solution (Catalog # DY994).
Recombinant Human Growth Hormone (Catalog # 1067-GH) stimulates proliferation in the Nb2‑11 rat lymphoma cell line in a dose-dependent manner (orange line). Proliferation elicited by Recombinant Human Growth Hormone (0.2 ng/mL) is neutralized (green line) by increasing concentrations of Goat Anti-Human/Mouse/Rat Growth Hormone Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1067). The ND50 is typically 1.5-7.5 ng/mL.
(3 Reviews)
(9 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
gamma-glutamyl
hydrolase Antibody
NBP1-90927
Western Blot: gamma-glutamyl hydrolase Antibody [NBP1-90927] - Analysis in control (vector only transfected HEK293T lysate) and GGH over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: gamma-glutamyl hydrolase Antibody [NBP1-90927] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: gamma-glutamyl hydrolase Antibody [NBP1-90927] - Staining of human testis shows strong granular cytoplasmic positivity in Leydig cells.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
Growth Hormone
Antibody [Unconjugate
AF1067
Western blot shows lysates of human, mouse, and rat pituitary gland tissue. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human Growth Hormone Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1067) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Growth Hormone at approximately 22 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Recombinant Human Growth Hormone protein was serially diluted 2-fold and captured by Mouse Anti-Human Growth Hormone Monoclonal Antibody (Catalog # MAB10671) coated on a Clear Polystyrene Microplate (Catalog # DY990). Goat Anti-Human/Mouse/Rat Growth Hormone Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1067) was biotinylated and incubated with the protein captured on the plate. Detection of the standard curve was achieved by incubating Streptavidin-HRP (Catalog # DY998) followed by Substrate Solution (Catalog # DY999) and stopping the enzymatic reaction with Stop Solution (Catalog # DY994).
Recombinant Human Growth Hormone (Catalog # 1067-GH) stimulates proliferation in the Nb2‑11 rat lymphoma cell line in a dose-dependent manner (orange line). Proliferation elicited by Recombinant Human Growth Hormone (0.2 ng/mL) is neutralized (green line) by increasing concentrations of Goat Anti-Human/Mouse/Rat Growth Hormone Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1067). The ND50 is typically 1.5-7.5 ng/mL.
(3 Reviews)
(9 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
PBX1 Antibody (4A2)
H00005087-M01
Western Blot: PBX1 Antibody (4A2) [H00005087-M01] - PBX1 monoclonal antibody (M01), clone 4A2 Analysis of PBX1 expression in Hela S3 NE.
Immunocytochemistry/Immunofluorescence: PBX1 Antibody (4A2) [H00005087-M01] - Analysis of monoclonal antibody to PBX1 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: PBX1 Antibody (4A2) [H00005087-M01] - Analysis of monoclonal antibody to PBX1 on formalin-fixed paraffin-embedded human salivary gland. Antibody concentration 3 ug/ml.
(9 Publications)
Species: Hu, Pm, Mu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
PROP1 Antibody
NBP2-68688
Immunohistochemistry-Paraffin: PROP1 Antibody [NBP2-68688] - Staining of human anterior pituitary gland shows strong nuclear positivity.
Species: Hu
Applications: IHC, IHC-P
POMC Antibody
NB100-1533
Western Blot: POMC Antibody [NB100-1533] - Staining of NIH3T3 cell lysate with antibody at 0.3 ug/mL (A) and Rat Brain cell lysate with antibody at 2 ug/mL (B). 35 ug protein in RIPA buffer. Detected by chemiluminescence.
Flow Cytometry: POMC Antibody [NB100-1533] - Flow cytometric analysis of paraformaldehyde fixed A431 cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
Immunohistochemistry: POMC Antibody [NB100-1533] - Representative immunofluorescence images of (B) POMC as a prohormone (n = 5-6 each) in the ARC of mice approximately 5 to 10 weeks of age. Image collected and cropped by CiteAb from the following publication (jci.org/articles/view/96420), licensed under a CC-BY licence.
(10 Publications)
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Thyrotropin
Releasing Hormone Ant
NBP2-94348
Western Blot: Thyrotropin Releasing Hormone Antibody [NBP2-94348] - Analysis of extracts of various cell lines, using Thyrotropin Releasing Hormone at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 90s.
Immunocytochemistry/Immunofluorescence: Thyrotropin Releasing Hormone Antibody [NBP2-94348] - Analysis of U2OS cells using TRH Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunocytochemistry/Immunofluorescence: Thyrotropin Releasing Hormone Antibody [NBP2-94348] - Analysis of L929 cells using TRH Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
IGF-I/IGF-1
[Unconjugated]
291-G1
1 μg/lane of Recombinant Human IGF-I/IGF-1 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 7 kDa.
Recombinant Human IGF-I/IGF-1 (Catalog # 291-G1) stimulates proliferation in the MCF-7 human breast cancer cell line. The ED50 for this effect is 0.3‑1.5 ng/mL.
MALDI-TOF analysis of Recombinant Human IGF-I/IGF-1.The major peak corresponds to the calculated molecular mass, 7650 Da. The minor peak at 7873 is a matrix-associated artifact of the MALDI-TOF.
(8 Reviews)
(173 Publications)
Species: Hu
Applications: BA
OCT1 Antibody
NBP2-24677
Immunocytochemistry/Immunofluorescence: OCT1 Antibody [NBP2-24677] - NTERA2 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-OCT1 at 2 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Alpha tubulin (DM1A) NB100-690 was used as a co-stain at a 1:1000 dilution and detected with an anti-mouse Dylight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: OCT1 Antibody [NBP2-24677] - Analysis of OCT-1 in formalin-fixed, paraffin-embedded human liver tissue using an isotype control (top) and this antibody (bottom) at 5 ug/ml.
Western Blot: OCT1 Antibody [NBP2-24677] - Western blot analysis of OCT-1 in human HL60 cell lysate using NBP2-24677 at 4 ug/ml.
Species: Ca, Eq, Hu, Pm
Applications: ICC/IF, IHC, IHC-P, WB
GHRH 293T Cell
Transient Overexpress ...
H00002691-T01
Lane 1: GHRH transfected lysate (12.4 KDa) Lane 2: Non-transfected lysate.
GHRH transfected lysate.
Species: Hu
Applications: WB
SLC20A2 Antibody
(4B1)
H00006575-M04
ELISA: SLC20A2 Antibody (4B1) [H00006575-M04] - Detection limit for recombinant GST tagged SLC20A2 is 0.3 ng/ml as a capture antibody.
(2 Publications)
Species: Hu, Mu
Applications: ELISA, WB
HESX1 Antibody
NBP1-89090
Immunohistochemistry-Paraffin: HESX1 Antibody [NBP1-89090] - Staining of human skeletal muscle shows no nuclear positivity in striated muscle fibers as expected.
Immunohistochemistry-Paraffin: HESX1 Antibody [NBP1-89090] - Staining of human skin shows strong nuclear positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: HESX1 Antibody [NBP1-89090] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts as well as in Leydig cells.
Species: Hu
Applications: IHC, IHC-P
PITX2 Antibody
[Unconjugated]
AF7388
PITX2 was detected in immersion fixed paraffin-embedded sections of human thyroid cancer tissue using Sheep Anti-Human PITX2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7388) at 3 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counter­stained with hematoxylin (blue). Specific staining was localized to nuclei. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(2 Reviews)
(4 Publications)
Species: Hu
Applications: IHC
CBP/KAT3A Antibody
NB100-381
Western Blot: CBP/KAT3A Antibody [NB100-381] - Detection of Human CBP by Western Blot. Samples: Whole cell lysate (5, 15 and 50 ug) from HeLa cells. Antibodies: Affinity purified rabbit anti-CBP antibody NB100-381 used for WB at 0.4 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Immunoprecipitation: CBP/KAT3A Antibody [NB100-381] - Whole cell lysate (1 mg for IP; 20% of IP loaded) from HeLa cells. Antibodies: Affinity purified rabbit anti-CBP antibody used for IP at 6 ug/mg lysate. CBP was also immunoprecipitated by rabbit anti-CBP antibody NB100-382. For blotting immunoprecipitated CBP, was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
(2 Reviews)
(1 Publication)
Species: Hu
Applications: ChIP, IP, WB
LHX3 Antibody
NBP3-13352
Immunohistochemistry-Paraffin: LHX3 Antibody [NBP3-13352] - LHX3 antibody detects LHX3 protein at nucleus by immunohistochemical analysis. Sample: Paraffin-embedded mouse E10.5 embryo. Green: LHX3 stained by LHX3 antibody (NBP3-13352) diluted at 1:500. Red: SOX2, a nucleus marker, stained by SOX2 antibody [GT1352] (NBP2-19306) diluted at 1:250. Blue: Fluoroshield with DAPI. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min
Immunocytochemistry/Immunofluorescence: LHX3 Antibody [NBP3-13352] - LHX3 antibody detects LHX3 protein by immunofluorescent analysis. Sample: DIV10 rat E18 primary cortical neuron cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: LHX3 stained by LHX3 antibody (NBP3-13352) diluted at 1:500. Red: Tau, stained by Tau antibody [GT287] diluted at 1:500. Blue: Fluoroshield with DAPI.
Western Blot: LHX3 Antibody [NBP3-13352] - Mouse tissue extract (50 ug) was separated by 12% SDS-PAGE, and the membrane was blotted with LHX3 antibody (NBP3-13352) diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
c-jun [p Ser63]
Antibody (SY0297)
NBP2-67471
Immunocytochemistry/Immunofluorescence: c-jun [p Ser63] Antibody (SY0297) [NBP2-67471] - Staining Phospho-c-Jun(S63) in A549 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: c-jun [p Ser63] Antibody (SY0297) [NBP2-67471] - Staining Phospho-c-Jun(S63) in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: c-jun [p Ser63] Antibody (SY0297) [NBP2-67471] - Analysis of paraffin-embedded human breast carcinoma tissue using anti-Phospho-c-Jun(S63) antibody. Counter stained with hematoxylin.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
GHRHR Antibody -
BSA Free
NLS836
Immunohistochemistry-Paraffin: GHRHR Antibody [NLS836] - Analysis of anti-GHRHR antibody with human pituitary, anterior.
Immunohistochemistry-Paraffin: GHRHR Antibody [NLS836] - Analysis of anti-GHRHR antibody with human ovary, carcinoma.
Immunohistochemistry-Paraffin: GHRHR Antibody [NLS836] - Anti-GHRHR antibody IHC of human Pancreas, Carcinoma. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Species: Hu, Pm, Pm
Applications: IHC, IHC-P
Adenine Nucleotide
Translocator 2 Antibo ...
NBP2-92630
Immunocytochemistry/Immunofluorescence: Adenine Nucleotide Translocator 2 Antibody [NBP2-92630] - Analysis of HeLa cells using Adenine Nucleotide Translocator 2 . Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: Adenine Nucleotide Translocator 2 Antibody [NBP2-92630] - Paraffin-embedded mouse heart using Adenine Nucleotide Translocator 2 .
Western Blot: Adenine Nucleotide Translocator 2 Antibody [NBP2-92630] - Analysis of extracts of various cell lines, using Adenine Nucleotide Translocator 2 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 60s.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

SF-1/NR5A1/Steroidogen ...
NBP2-88921
Immunocytochemistry/Immunofluorescence: SF-1/NR5A1/Steroidogenic Factor 1 Antibody (CL9101) [NBP2-88921] - Staining of U-2 OS cells using the Anti-NR5A1 monoclonal antibody, showing specific staining in the nucleoplasm in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).
Immunohistochemistry-Paraffin: SF-1/NR5A1/Steroidogenic Factor 1 Antibody (CL9101) [NBP2-88921] - Staining of human adrenal gland shows moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: SF-1/NR5A1/Steroidogenic Factor 1 Antibody (CL9101) [NBP2-88921] - Staining of human breast shows weak to moderate nuclear positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for Pit1 Antibody (NBP1-92273)(15)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 4 applications: ICC/IF, IHC, IHC-P, WB.


Filter By Application
ICC/IF
(1)
IHC
(5)
IHC-P
(5)
WB
(1)
All Applications
Filter By Species
Human
(12)
Mouse
(1)
All Species
Showing Publications 1 - 10 of 15. Show All 15 Publications.
Publications using NBP1-92273 Applications Species
Hong SW, Kim SH, Lim SH et al. Clinical Relevance of New World Health Organization Classification System for Pituitary Adenomas: A Validation Study With 2-Year Experience Frontiers in oncology Sep 13 2021 [PMID: 34589436] (IHC, Human) IHC Human
Tjornstrand A, Casar-Borota O, Heurling K, et al. Pre- and postoperative 68 Ga-DOTATOC positron emission tomography for hormone-secreting pituitary neuroendocrine tumors Clinical endocrinology Jan 23 2021 [PMID: 33484167] (IHC-P, Human) IHC-P Human
Taniguchi-Ponciano K, Pena-MartInez E, Silva-Roman G et al. Proteomic and Transcriptomic Analysis Identify Spliceosome as a Significant Component of the Molecular Machinery in the Pituitary Tumors Derived from POU1F1- and NR5A1-Cell Lineages Genes Nov 27 2020 [PMID: 33261069] (IHC-P, Human)

Details:
Immunohistochemical analysis of normal/tumor human pituitary tissue. 		IHC-P Human
Taniguchi-Ponciano K, Andonegui-Elguera S, PeNa-MartInez E et al. Transcriptome and methylome analysis reveals three cellular origins of pituitary tumors Sci Rep Nov 9 2020 [PMID: 33168897] (IHC-P, Human)

Details:
Immunohistochemical analysis of paraffin-embedded human pituitary adenomas. 		IHC-P Human
Casar-Borota, O, Boldt, H B Et al. Corticotroph Aggressive Pituitary Tumors and Carcinomas Frequently Harbor ATRX Mutations. J Clin Endocrinol Metab Mar 25 2021 [PMID: 33106857] (ICC/IF, WB, Human) ICC/IF, WB Human
Abboud D, Daly AF, Dupuis N et al. GPR101 drives growth hormone hypersecretion and gigantism in mice via constitutive activation of Gs and Gq/11 Nat Commun Sep 21 2020 [PMID: 32958754] (IHC-P, Mouse) IHC-P Mouse
Neou M, Villa C, Armignacco R, et al. Pangenomic Classification of Pituitary Neuroendocrine Tumors Cancer Cell Dec 11 2019 [PMID: 31883967]
TjOrnstrand A, Casar-Borota O, Heurling K, et al. Lower 68 Ga-DOTATOC Uptake in Non-Functioning Pituitary Neuroendocrine Tumors Compared to Normal Pituitary Gland - a Proof-of-Concept Study Clin. Endocrinol. (Oxf) Dec 23 2019 [PMID: 31868239]
Capraru O, Gaillard C, Vasiljevic A et al. Diagnosis, pathology, and management of TSH-secreting pituitary tumors. A single-center retrospective study of 20 patients from 1981 to 2014 Annales d'Endocrinologie Jul 1 2019 [PMID: 31400861] (IHC, Human) IHC Human
You J, Li M, Cao LM et al. Comprehensive analysis of circulating microRNAs in plasma of patients with pituitary adenomas J. Clin. Endocrinol. Metab. May 21 2019 [PMID: 31112271] (IHC, Human) IHC Human
Show All 15 Publications.

Reviews for Pit1 Antibody (NBP1-92273) (0)

There are no reviews for Pit1 Antibody (NBP1-92273). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Pit1 Antibody (NBP1-92273) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Pit1 Products

Bioinformatics Tool for Pit1 Antibody (NBP1-92273)

Discover related pathways, diseases and genes to Pit1 Antibody (NBP1-92273). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Pit1 Antibody (NBP1-92273)

Discover more about diseases related to Pit1 Antibody (NBP1-92273).
 

Pathways for Pit1 Antibody (NBP1-92273)

View related products by pathway.

PTMs for Pit1 Antibody (NBP1-92273)

Learn more about PTMs related to Pit1 Antibody (NBP1-92273).
 

Research Areas for Pit1 Antibody (NBP1-92273)

Find related products by research area.

Blogs on Pit1

There are no specific blogs for Pit1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Pit1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol POU1F1