Home » Pit1 » Pit1 Antibodies » Pit1 Antibody

Pit1 Antibody

 (3 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: Pit1 Antibody [NBP1-92273] - Staining of human pituitary gland shows moderate to strong nuclear positivity in neuroendocrine cells in the anterior lobe.
Immunohistochemistry-Paraffin: Pit1 Antibody [NBP1-92273] - Staining of human pituitary gland shows moderate to strong nuclear positivity in neuroendocrine cells in the anterior lobe.
Immunohistochemistry-Paraffin: Pit1 Antibody [NBP1-92273] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Pit1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: CKLKAILSKWLEEAEQVGALYNEKVGANERKRKRRTTISIAAKDALERHFGEQNKPSSQEIMRMAE
Specificity
Specificity of human Pit1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
POU1F1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Pit1 Protein (NBP1-92273PEP)
Publications
Read Publications using
NBP1-92273 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Pit1 Antibody

  • CPHD1
  • GHF1
  • GHF-1pituitary-specific positive transcription factor 1
  • Growth hormone factor 1
  • Pit-1
  • PIT1pituitary-specific transcription factor 1
  • POU class 1 homeobox 1
  • POU domain class 1, transcription factor 1
  • POU domain, class 1, transcription factor 1
  • POU1F1a

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Prolactin Antibody
(OTI6B1)
NBP2-02142
Western Blot: Prolactin Antibody (6B1) [NBP2-02142] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Prolactin (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Prolactin.
Immunocytochemistry/Immunofluorescence: Prolactin Antibody (6B1) [NBP2-02142] Staining of COS7 cells transiently transfected by pCMV6-ENTRY Prolactin.
Immunohistochemistry-Paraffin: Prolactin Antibody (6B1) [NBP2-02142] - Staining of paraffin-embedded Human Ovary tissue using anti-Prolactin mouse monoclonal antibody.
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Growth Hormone
Antibody [Unconjugate
AF1067
Western blot shows lysates of human, mouse, and rat pituitary gland tissue. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human Growth Hormone Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1067) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Growth Hormone at approximately 22 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Recombinant Human Growth Hormone protein was serially diluted 2-fold and captured by Mouse Anti-Human Growth Hormone Monoclonal Antibody (Catalog # MAB10671) coated on a Clear Polystyrene Microplate (Catalog # DY990). Goat Anti-Human/Mouse/Rat Growth Hormone Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1067) was biotinylated and incubated with the protein captured on the plate. Detection of the standard curve was achieved by incubating Streptavidin-HRP (Catalog # DY998) followed by Substrate Solution (Catalog # DY999) and stopping the enzymatic reaction with Stop Solution (Catalog # DY994).
Recombinant Human Growth Hormone (Catalog # 1067-GH) stimulates proliferation in the Nb2‑11 rat lymphoma cell line in a dose-dependent manner (orange line). Proliferation elicited by Recombinant Human Growth Hormone (0.2 ng/mL) is neutralized (green line) by increasing concentrations of Goat Anti-Human/Mouse/Rat Growth Hormone Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1067). The ND50 is typically 1.5-7.5 ng/mL.
(3 Reviews)
(6 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
Recombinant Human
gamma-glutamyl hydrol ...
NBP1-78898
SDS-Page: Recombinant Human gamma-glutamyl hydrolase Protein [NBP1-78898]
Species: Hu
Growth Hormone
Antibody [Unconjugate
AF1067
Western blot shows lysates of human, mouse, and rat pituitary gland tissue. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human Growth Hormone Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1067) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Growth Hormone at approximately 22 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Recombinant Human Growth Hormone protein was serially diluted 2-fold and captured by Mouse Anti-Human Growth Hormone Monoclonal Antibody (Catalog # MAB10671) coated on a Clear Polystyrene Microplate (Catalog # DY990). Goat Anti-Human/Mouse/Rat Growth Hormone Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1067) was biotinylated and incubated with the protein captured on the plate. Detection of the standard curve was achieved by incubating Streptavidin-HRP (Catalog # DY998) followed by Substrate Solution (Catalog # DY999) and stopping the enzymatic reaction with Stop Solution (Catalog # DY994).
Recombinant Human Growth Hormone (Catalog # 1067-GH) stimulates proliferation in the Nb2‑11 rat lymphoma cell line in a dose-dependent manner (orange line). Proliferation elicited by Recombinant Human Growth Hormone (0.2 ng/mL) is neutralized (green line) by increasing concentrations of Goat Anti-Human/Mouse/Rat Growth Hormone Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1067). The ND50 is typically 1.5-7.5 ng/mL.
(3 Reviews)
(6 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
PBX1 Antibody (4A2)
H00005087-M01
Western Blot: PBX1 Antibody (4A2) [H00005087-M01] - PBX1 monoclonal antibody (M01), clone 4A2 Analysis of PBX1 expression in Hela S3 NE.
Immunocytochemistry/Immunofluorescence: PBX1 Antibody (4A2) [H00005087-M01] - Analysis of monoclonal antibody to PBX1 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: PBX1 Antibody (4A2) [H00005087-M01] - Analysis of monoclonal antibody to PBX1 on formalin-fixed paraffin-embedded human salivary gland. Antibody concentration 3 ug/ml.
(8 Publications)
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
PROP1 Antibody
NBP2-68688
Immunohistochemistry-Paraffin: PROP1 Antibody [NBP2-68688] - Immunohistochemical staining of human anterior pituitary gland shows strong nuclear positivity.
Species: Hu
Applications: IHC, IHC-P
POMC Antibody
NB100-1533
Western Blot: POMC Antibody [NB100-1533] - Western blot analysis of POMC using NB100-1533 at 0.01ug/ml in NIH 3T3 lysate (35ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
Immunohistochemistry-Paraffin: POMC Antibody [NB100-1533] - Analysis in human Anterior Pituitary Gland shows vesilulate staining in glandular cells.
(7 Publications)
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Thyrotropin
Releasing Hormone Ant
NBP2-34014
Immunohistochemistry-Paraffin: Thyrotropin Releasing Hormone Antibody [NBP2-34014] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: Thyrotropin Releasing Hormone Antibody [NBP2-34014] - Analysis in human cervix, uterine and skeletal muscle tissues. Corresponding TRH RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Thyrotropin Releasing Hormone Antibody [NBP2-34014] - Staining of human cervix, uterine shows moderate to strong cytoplasmic positivity in glandular cells.
Species: Hu
Applications: IHC, IHC-P
IGF-I
[Unconjugated]
291-G1
1 μg/lane of Recombinant Human IGF-I was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 7 kDa.
Recombinant Human IGF-I (Catalog # 291-G1) stimulates proliferation in the MCF-7 human breast cancer cell line. The ED50 for this effect is 0.3‑1.5 ng/mL.
MALDI-TOF analysis of Recombinant Human IGF-I.The major peak corresponds to the calculated molecular mass, 7650 Da. The minor peak at 7873 is a matrix-associated artifact of the MALDI-TOF.
(3 Reviews)
(108 Publications)
Species: Hu
OCT1 Antibody
NBP2-21584
Western Blot: OCT1 Antibody [NBP2-21584] - Sample (30 ug of whole cell lysate) A: 293T B: A431 C: HeLa D: HepG2 7. 5% SDS PAGE gel, diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: OCT1 Antibody [NBP2-21584] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: OCT1 protein stained by OCT1 antibody diluted at 1:500. Red: phalloidin, a cytoskeleton marker, stained by () diluted at 1:200. Blue: Hoechst 33342 staining. Scale bar = 10 um.
Immunohistochemistry-Paraffin: OCT1 Antibody [NBP2-21584] - Paraffin-embedded rat brain. OCT1 antibody diluted at 1:500.
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
GHRH Antibody
NBP2-29915
Western Blot: GHRH Antibody [NBP2-29915] - Western blot analysis in MDA-MB231 cell line lysates (35ug/lane).This demonstrates the GHRH antibody detected the GHRH protein (arrow).
Immunocytochemistry/Immunofluorescence: GHRH Antibody [NBP2-29915] - Confocal immunofluorescent analysis of GHRH Antibody (N-term) with 293 cell followed by Alexa Fluor 488-conjugated goat anti-rabbit lgG (green). DAPI was used to stain the cell nuclear (blue).
Immunohistochemistry-Paraffin: GHRH Antibody [NBP2-29915] - Formalin-fixed and paraffin-embedded human lung carcinoma tissue reacted with GHRH antibody (N-term) (Cat.#NBP2-29915), which was peroxidase-conjugated to the secondary antibody, followed by DAB staining. This data demonstrates the use of this antibody for immunohistochemistry; clinical relevance has not been evaluated.
Species: Hu
Applications: WB, ICC/IF, IHC-P
SLC20A2 Antibody
NBP1-83360
Immunohistochemistry-Paraffin: SLC20A2 Antibody [NBP1-83360] - Staining of human fallopian tube shows strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: SLC20A2 Antibody [NBP1-83360] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.
Species: Hu
Applications: IHC, IHC-P
HESX1 Antibody
NBP1-89090
Immunohistochemistry-Paraffin: HESX1 Antibody [NBP1-89090] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts as well as in Leydig cells.
Immunohistochemistry-Paraffin: HESX1 Antibody [NBP1-89090] - Staining of human skeletal muscle shows no nuclear positivity in striated muscle fibers as expected.
Immunohistochemistry-Paraffin: HESX1 Antibody [NBP1-89090] - Staining of human skin shows strong nuclear positivity in squamous epithelial cells.
Species: Hu
Applications: IHC, IHC-P
PITX2 Antibody
(2G6)
H00005308-M01
Immunocytochemistry/Immunofluorescence: PITX2 Antibody (2G6) [H00005308-M01] - Analysis of monoclonal antibody to PITX2 on HeLa cell. Antibody concentration 10 ug/ml.
ELISA: PITX2 Antibody (2G6) [H00005308-M01] - Detection limit for recombinant GST tagged PITX2 is approximately 0.03ng/ml as a capture antibody.
(4 Publications)
Species: Hu
Applications: WB, ELISA, ICC/IF
CBP/KAT3A Antibody
NB100-381
Western Blot: CBP/KAT3A Antibody [NB100-381] - Detection of Human CBP by Western Blot. Samples: Whole cell lysate (5, 15 and 50 ug) from HeLa cells. Antibodies: Affinity purified rabbit anti-CBP antibody NB100-381 used for WB at 0.4 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Immunoprecipitation: CBP/KAT3A Antibody [NB100-381] - Whole cell lysate (1 mg for IP; 20% of IP loaded) from HeLa cells. Antibodies: Affinity purified rabbit anti-CBP antibody used for IP at 6 ug/mg lysate. CBP was also immunoprecipitated by rabbit anti-CBP antibody NB100-382. For blotting immunoprecipitated CBP, was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
(2 Reviews)
(1 Publication)
Species: Hu
Applications: WB, ChIP, IP
Recombinant Human
LHX3 Protein
H00008022-Q01
SDS-Page: Recombinant Human LHX3 Protein [H00008022-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
c-jun [p Ser63]
Antibody (SY0297)
NBP2-67471
Western Blot: c-jun [p Ser63] Antibody (SY0297) [NBP2-67471] - Analysis of Phospho-c-Jun(S63) on different lysates using anti-Phospho-c-Jun(S63) antibody at 1/1,000 dilution. Positive control: Lane 1: NIH/3T3 Lane 2: 293T
Immunocytochemistry/Immunofluorescence: c-jun [p Ser63] Antibody (SY0297) [NBP2-67471] - Staining Phospho-c-Jun(S63) in PC-3M cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: c-jun [p Ser63] Antibody (SY0297) [NBP2-67471] - Analysis of paraffin-embedded human tonsil tissue using anti-Phospho-c-Jun(S63) antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
GHRHR Antibody
NLS836
Immunohistochemistry-Paraffin: GHRHR Antibody [NLS836] - Anti-GHRHR antibody IHC of human Pancreas, Carcinoma. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Immunohistochemistry-Paraffin: GHRHR Antibody [NLS836] - Analysis of anti-GHRHR antibody with human pituitary, anterior.
Immunohistochemistry-Paraffin: GHRHR Antibody [NLS836] - Analysis of anti-GHRHR antibody with human pituitary, anterior.
Species: Hu, Mk, Pm
Applications: IHC-P
Adenine Nucleotide
Translocator 2 Antibo ...
NBP2-57642
Western Blot: Adenine Nucleotide Translocator 2 Antibody [NBP2-57642] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunohistochemistry-Paraffin: Adenine Nucleotide Translocator 2 Antibody [NBP2-57642] - Immunohistochemical staining of human heart muscle shows strong cytoplasmic positivity in myocytes.
Species: Hu
Applications: WB, IHC, IHC-P

SF-1/NR5A1/Steroidogen ...
PP-N1665-00
SF-1/NR5A1/Steroidogenic Factor 1 Antibody (N1665)
(2 Reviews)
(1 Publication)
Species: Hu
Applications: WB, IHC, IP

Publications for Pit1 Antibody (NBP1-92273)(3)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC-P.


Filter By Application
IHC-P
(1)
All Applications
Filter By Species
Human
(3)
All Species

Reviews for Pit1 Antibody (NBP1-92273) (0)

There are no reviews for Pit1 Antibody (NBP1-92273). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Pit1 Antibody (NBP1-92273) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Pit1 Antibody (NBP1-92273)

Discover related pathways, diseases and genes to Pit1 Antibody (NBP1-92273). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Pit1 Antibody (NBP1-92273)

Discover more about diseases related to Pit1 Antibody (NBP1-92273).
 

Pathways for Pit1 Antibody (NBP1-92273)

View related products by pathway.

PTMs for Pit1 Antibody (NBP1-92273)

Learn more about PTMs related to Pit1 Antibody (NBP1-92273).
 

Research Areas for Pit1 Antibody (NBP1-92273)

Find related products by research area.

Blogs on Pit1

There are no specific blogs for Pit1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Pit1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol POU1F1