Pit1 Antibody

Images

 
Immunohistochemistry-Paraffin: Pit1 Antibody [NBP1-92273] - Staining of human pituitary gland shows moderate to strong nuclear positivity in neuroendocrine cells in the anterior lobe.
Immunohistochemistry-Paraffin: Pit1 Antibody [NBP1-92273] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Pit1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: CKLKAILSKWLEEAEQVGALYNEKVGANERKRKRRTTISIAAKDALERHFGEQNKPSSQEIMRMAE
Specificity
Specificity of human Pit1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
POU1F1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Pit1 Protein (NBP1-92273PEP)
Publications
Read Publications using
NBP1-92273 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Pit1 Antibody

  • CPHD1
  • GHF1
  • GHF-1pituitary-specific positive transcription factor 1
  • Growth hormone factor 1
  • Pit-1
  • PIT1pituitary-specific transcription factor 1
  • POU class 1 homeobox 1
  • POU domain class 1, transcription factor 1
  • POU domain, class 1, transcription factor 1
  • POU1F1a

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02142
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
AF1067
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
H00005087-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-68688
Species: Hu
Applications: IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-34014
Species: Hu
Applications: IHC, IHC-P
NBP2-21584
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-29915
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP1-83360
Species: Hu
Applications: IHC, IHC-P
NBP1-89090
Species: Hu
Applications: IHC, IHC-P
H00005308-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-381
Species: Hu
Applications: WB, ChIP, IP
H00008022-Q01
Species: Hu
NBP2-67471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NLS836
Species: Hu, Mk, Pm
Applications: IHC-P
NBP2-57642
Species: Hu
Applications: WB, IHC, IHC-P
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP

Publications for Pit1 Antibody (NBP1-92273)(3)

Reviews for Pit1 Antibody (NBP1-92273) (0)

There are no reviews for Pit1 Antibody (NBP1-92273). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Pit1 Antibody (NBP1-92273) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Pit1 Antibody (NBP1-92273)

Discover related pathways, diseases and genes to Pit1 Antibody (NBP1-92273). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Pit1 Antibody (NBP1-92273)

Discover more about diseases related to Pit1 Antibody (NBP1-92273).
 

Pathways for Pit1 Antibody (NBP1-92273)

View related products by pathway.

PTMs for Pit1 Antibody (NBP1-92273)

Learn more about PTMs related to Pit1 Antibody (NBP1-92273).
 

Research Areas for Pit1 Antibody (NBP1-92273)

Find related products by research area.

Blogs on Pit1

There are no specific blogs for Pit1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Pit1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol POU1F1