Pit1 Antibody

Images

 
Independent Antibodies: Immunohistochemistry-Paraffin: Pit1 Antibody [NBP1-92273] - Staining of human liver, pancreas, pituitary gland and tonsil using Anti-POU1F1 antibody NBP1-92273 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: Pit1 Antibody [NBP1-92273] - Staining of human pituitary gland shows moderate to strong nuclear positivity in neuroendocrine cells in the anterior lobe.
Immunohistochemistry-Paraffin: Pit1 Antibody [NBP1-92273] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Pit1 Antibody [NBP1-92273] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.
Immunohistochemistry-Paraffin: Pit1 Antibody [NBP1-92273] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

Pit1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: CKLKAILSKWLEEAEQVGALYNEKVGANERKRKRRTTISIAAKDALERHFGEQNKPSSQEIMRMAE
Predicted Species
Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
POU1F1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
IHC-P, Retrieval method: HIER pH6
Control Peptide
Pit1 Protein (NBP1-92273PEP)
Publications
Read Publications using
NBP1-92273 in the following applications:

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID:32958754)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Pit1 Antibody

  • CPHD1
  • GHF1
  • GHF-1pituitary-specific positive transcription factor 1
  • Growth hormone factor 1
  • Pit-1
  • PIT1pituitary-specific transcription factor 1
  • POU class 1 homeobox 1
  • POU domain class 1, transcription factor 1
  • POU domain, class 1, transcription factor 1
  • POU1F1a

Background

The Pit1 gene encodes a member of the POU family of transcription factors that regulate mammalian development. The protein regulates expression of several genes involved in pituitary development and hormone expression. Mutations in this genes result in combin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF682
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, WB
AF1067
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
NBP1-90927
Species: Hu
Applications: IHC, IHC-P, WB
AF1067
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
H00005087-M01
Species: Hu, Pm, Mu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
NBP3-10488
Species: Hu
Applications: WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP2-94348
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
291-G1
Species: Hu
Applications: BA
NBP2-24677
Species: Ca, Eq, Hu, Pm
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-04850
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
H00006575-M04
Species: Hu, Mu
Applications: ELISA, WB
NBP1-89090
Species: Hu
Applications: IHC, IHC-P
AF7388
Species: Hu
Applications: IHC
MAB2676
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP3-13352
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
NLS836
Species: Hu, Pm, Pm
Applications: IHC, IHC-P
NBP2-92630
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-52823
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB

Publications for Pit1 Antibody (NBP1-92273)(16)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 4 applications: ICC/IF, IF/IHC, IHC-P, WB.


Filter By Application
ICC/IF
(1)
IF/IHC
(5)
IHC-P
(6)
WB
(1)
All Applications
Filter By Species
Human
(12)
Mouse
(2)
All Species
Showing Publications 1 - 10 of 16. Show All 16 Publications.
Publications using NBP1-92273 Applications Species
Duan S, Sawyer TW, Sontz RA et al. GFAP-directed Inactivation of Men1 Exploits Glial Cell Plasticity in Favor of Neuroendocrine Reprogramming Cellular and molecular gastroenterology and hepatology 2022-07-11 [PMID: 35835391] (IHC-P, Mouse) IHC-P Mouse
Hong SW, Kim SH, Lim SH et al. Clinical Relevance of New World Health Organization Classification System for Pituitary Adenomas: A Validation Study With 2-Year Experience Frontiers in oncology 2021-09-13 [PMID: 34589436] (IF/IHC, Human) IF/IHC Human
Tjornstrand A, Casar-Borota O, Heurling K, et al. Pre- and postoperative 68 Ga-DOTATOC positron emission tomography for hormone-secreting pituitary neuroendocrine tumors Clinical endocrinology 2021-01-23 [PMID: 33484167] (IHC-P, Human) IHC-P Human
Taniguchi-Ponciano K, Pena-MartInez E, Silva-Roman G et al. Proteomic and Transcriptomic Analysis Identify Spliceosome as a Significant Component of the Molecular Machinery in the Pituitary Tumors Derived from POU1F1- and NR5A1-Cell Lineages Genes 2020-11-27 [PMID: 33261069] (IHC-P, Human)

Details:
Immunohistochemical analysis of normal/tumor human pituitary tissue.
IHC-P Human
Taniguchi-Ponciano K, Andonegui-Elguera S, PeNa-MartInez E et al. Transcriptome and methylome analysis reveals three cellular origins of pituitary tumors Sci Rep 2020-11-09 [PMID: 33168897] (IHC-P, Human)

Details:
Immunohistochemical analysis of paraffin-embedded human pituitary adenomas.
IHC-P Human
Casar-Borota, O, Boldt, H B Et al. Corticotroph Aggressive Pituitary Tumors and Carcinomas Frequently Harbor ATRX Mutations. J Clin Endocrinol Metab 2021-03-25 [PMID: 33106857] (WB, ICC/IF, Human) WB, ICC/IF Human
Abboud D, Daly AF, Dupuis N et al. GPR101 drives growth hormone hypersecretion and gigantism in mice via constitutive activation of Gs and Gq/11 Nat Commun 2020-09-21 [PMID: 32958754] (IHC-P, Mouse) IHC-P Mouse
Neou M, Villa C, Armignacco R, et al. Pangenomic Classification of Pituitary Neuroendocrine Tumors Cancer Cell 2019-12-11 [PMID: 31883967]
TjOrnstrand A, Casar-Borota O, Heurling K, et al. Lower 68 Ga-DOTATOC Uptake in Non-Functioning Pituitary Neuroendocrine Tumors Compared to Normal Pituitary Gland - a Proof-of-Concept Study Clin. Endocrinol. (Oxf) 2019-12-23 [PMID: 31868239]
Capraru O, Gaillard C, Vasiljevic A et al. Diagnosis, pathology, and management of TSH-secreting pituitary tumors. A single-center retrospective study of 20 patients from 1981 to 2014 Annales d'Endocrinologie 2019-07-01 [PMID: 31400861] (IF/IHC, Human) IF/IHC Human
Show All 16 Publications.

Reviews for Pit1 Antibody (NBP1-92273) (0)

There are no reviews for Pit1 Antibody (NBP1-92273). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Pit1 Antibody (NBP1-92273) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Pit1 Products

Bioinformatics Tool for Pit1 Antibody (NBP1-92273)

Discover related pathways, diseases and genes to Pit1 Antibody (NBP1-92273). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Pit1 Antibody (NBP1-92273)

Discover more about diseases related to Pit1 Antibody (NBP1-92273).
 

Pathways for Pit1 Antibody (NBP1-92273)

View related products by pathway.

PTMs for Pit1 Antibody (NBP1-92273)

Learn more about PTMs related to Pit1 Antibody (NBP1-92273).
 

Research Areas for Pit1 Antibody (NBP1-92273)

Find related products by research area.

Blogs on Pit1

There are no specific blogs for Pit1, but you can read our latest blog posts.
mFlour Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Pit1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol POU1F1