Pit1 Antibody


Independent Antibodies: Immunohistochemistry-Paraffin: Pit1 Antibody [NBP1-92273] - Staining of human liver, pancreas, pituitary gland and tonsil using Anti-POU1F1 antibody NBP1-92273 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: Pit1 Antibody [NBP1-92273] - Staining of human pituitary gland shows moderate to strong nuclear positivity in neuroendocrine cells in the anterior lobe.
Immunohistochemistry-Paraffin: Pit1 Antibody [NBP1-92273] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Pit1 Antibody [NBP1-92273] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.
Immunohistochemistry-Paraffin: Pit1 Antibody [NBP1-92273] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Validated by:

Independent Antibodies


Order Details

Pit1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: CKLKAILSKWLEEAEQVGALYNEKVGANERKRKRRTTISIAAKDALERHFGEQNKPSSQEIMRMAE
Predicted Species
Rat (97%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
IHC-P, Retrieval method: HIER pH6
Control Peptide
Pit1 Protein (NBP1-92273PEP)
Read Publications using
NBP1-92273 in the following applications:

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID:32958754)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Pit1 Antibody

  • CPHD1
  • GHF1
  • GHF-1pituitary-specific positive transcription factor 1
  • Growth hormone factor 1
  • Pit-1
  • PIT1pituitary-specific transcription factor 1
  • POU class 1 homeobox 1
  • POU domain class 1, transcription factor 1
  • POU domain, class 1, transcription factor 1
  • POU1F1a


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
Species: Hu, Pm, Mu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Ca, Eq, Hu, Pm
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: ELISA, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC
Species: Hu
Applications: ChIP, IP, WB
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Pm, Pm
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for Pit1 Antibody (NBP1-92273)(15)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 4 applications: ICC/IF, IHC, IHC-P, WB.

Filter By Application
All Applications
Filter By Species
All Species
Showing Publications 1 - 10 of 15. Show All 15 Publications.
Publications using NBP1-92273 Applications Species
Hong SW, Kim SH, Lim SH et al. Clinical Relevance of New World Health Organization Classification System for Pituitary Adenomas: A Validation Study With 2-Year Experience Frontiers in oncology Sep 13 2021 [PMID: 34589436] (IHC, Human) IHC Human
Tjornstrand A, Casar-Borota O, Heurling K, et al. Pre- and postoperative 68 Ga-DOTATOC positron emission tomography for hormone-secreting pituitary neuroendocrine tumors Clinical endocrinology Jan 23 2021 [PMID: 33484167] (IHC-P, Human) IHC-P Human
Taniguchi-Ponciano K, Pena-MartInez E, Silva-Roman G et al. Proteomic and Transcriptomic Analysis Identify Spliceosome as a Significant Component of the Molecular Machinery in the Pituitary Tumors Derived from POU1F1- and NR5A1-Cell Lineages Genes Nov 27 2020 [PMID: 33261069] (IHC-P, Human)

Immunohistochemical analysis of normal/tumor human pituitary tissue.
IHC-P Human
Taniguchi-Ponciano K, Andonegui-Elguera S, PeNa-MartInez E et al. Transcriptome and methylome analysis reveals three cellular origins of pituitary tumors Sci Rep Nov 9 2020 [PMID: 33168897] (IHC-P, Human)

Immunohistochemical analysis of paraffin-embedded human pituitary adenomas.
IHC-P Human
Casar-Borota, O, Boldt, H B Et al. Corticotroph Aggressive Pituitary Tumors and Carcinomas Frequently Harbor ATRX Mutations. J Clin Endocrinol Metab Mar 25 2021 [PMID: 33106857] (ICC/IF, WB, Human) ICC/IF, WB Human
Abboud D, Daly AF, Dupuis N et al. GPR101 drives growth hormone hypersecretion and gigantism in mice via constitutive activation of Gs and Gq/11 Nat Commun Sep 21 2020 [PMID: 32958754] (IHC-P, Mouse) IHC-P Mouse
Neou M, Villa C, Armignacco R, et al. Pangenomic Classification of Pituitary Neuroendocrine Tumors Cancer Cell Dec 11 2019 [PMID: 31883967]
TjOrnstrand A, Casar-Borota O, Heurling K, et al. Lower 68 Ga-DOTATOC Uptake in Non-Functioning Pituitary Neuroendocrine Tumors Compared to Normal Pituitary Gland - a Proof-of-Concept Study Clin. Endocrinol. (Oxf) Dec 23 2019 [PMID: 31868239]
Capraru O, Gaillard C, Vasiljevic A et al. Diagnosis, pathology, and management of TSH-secreting pituitary tumors. A single-center retrospective study of 20 patients from 1981 to 2014 Annales d'Endocrinologie Jul 1 2019 [PMID: 31400861] (IHC, Human) IHC Human
You J, Li M, Cao LM et al. Comprehensive analysis of circulating microRNAs in plasma of patients with pituitary adenomas J. Clin. Endocrinol. Metab. May 21 2019 [PMID: 31112271] (IHC, Human) IHC Human
Show All 15 Publications.

Reviews for Pit1 Antibody (NBP1-92273) (0)

There are no reviews for Pit1 Antibody (NBP1-92273). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Pit1 Antibody (NBP1-92273) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Pit1 Products

Bioinformatics Tool for Pit1 Antibody (NBP1-92273)

Discover related pathways, diseases and genes to Pit1 Antibody (NBP1-92273). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Pit1 Antibody (NBP1-92273)

Discover more about diseases related to Pit1 Antibody (NBP1-92273).

Pathways for Pit1 Antibody (NBP1-92273)

View related products by pathway.

PTMs for Pit1 Antibody (NBP1-92273)

Learn more about PTMs related to Pit1 Antibody (NBP1-92273).

Research Areas for Pit1 Antibody (NBP1-92273)

Find related products by research area.

Blogs on Pit1

There are no specific blogs for Pit1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Pit1 Antibody and receive a gift card or discount.


Gene Symbol POU1F1