Pit1 Antibody

Immunohistochemistry-Paraffin: Pit1 Antibody [NBP1-92273] - Staining of human liver, pancreas, pituitary gland and tonsil using Anti-POU1F1 antibody NBP1-92273 (A) shows similar protein distribution across tissues to independent antibody NBP2-55357 (B).

Immunohistochemistry-Paraffin: Pit1 Antibody [NBP1-92273] - Staining of human pituitary gland shows moderate to strong nuclear positivity in neuroendocrine cells in the anterior lobe.

Immunohistochemistry-Paraffin: Pit1 Antibody [NBP1-92273] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: Pit1 Antibody [NBP1-92273] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.

Immunohistochemistry-Paraffin: Pit1 Antibody [NBP1-92273] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Pit1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: CKLKAILSKWLEEAEQVGALYNEKVGANERKRKRRTTISIAAKDALERHFGEQNKPSSQEIMRMAE
• Predicted Species: Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: POU1F1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: IHC-P, Retrieval method: HIER pH6
• Control Peptide:

  Pit1 Protein (NBP1-92273PEP)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID:32958754)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Pit1 Antibody

• CPHD1
• GHF1
• GHF-1pituitary-specific positive transcription factor 1
• Growth hormone factor 1
• Pit-1
• PIT1pituitary-specific transcription factor 1
• POU class 1 homeobox 1
• POU domain class 1, transcription factor 1
• POU domain, class 1, transcription factor 1
• POU1F1a

Background

The Pit1 gene encodes a member of the POU family of transcription factors that regulate mammalian development. The protein regulates expression of several genes involved in pituitary development and hormone expression. Mutations in this genes result in combin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Pit1 Antibody (NBP1-92273)(16)

Publications using NBP1-92273

• Duan S, Sawyer TW, Sontz RA et al. GFAP-directed Inactivation of Men1 Exploits Glial Cell Plasticity in Favor of Neuroendocrine Reprogramming Cellular and molecular gastroenterology and hepatology 2022-07-11 [PMID: 35835391] (IHC-P, Mouse)
• Hong SW, Kim SH, Lim SH et al. Clinical Relevance of New World Health Organization Classification System for Pituitary Adenomas: A Validation Study With 2-Year Experience Frontiers in oncology 2021-09-13 [PMID: 34589436] (IF/IHC, Human)
• Tjornstrand A, Casar-Borota O, Heurling K, et al. Pre- and postoperative 68 Ga-DOTATOC positron emission tomography for hormone-secreting pituitary neuroendocrine tumors Clinical endocrinology 2021-01-23 [PMID: 33484167] (IHC-P, Human)
• Taniguchi-Ponciano K, Pena-MartInez E, Silva-Roman G et al. Proteomic and Transcriptomic Analysis Identify Spliceosome as a Significant Component of the Molecular Machinery in the Pituitary Tumors Derived from POU1F1- and NR5A1-Cell Lineages Genes 2020-11-27 [PMID: 33261069] (IHC-P, Human)
  
  Details:
  Immunohistochemical analysis of normal/tumor human pituitary tissue.
• Taniguchi-Ponciano K, Andonegui-Elguera S, PeNa-MartInez E et al. Transcriptome and methylome analysis reveals three cellular origins of pituitary tumors Sci Rep 2020-11-09 [PMID: 33168897] (IHC-P, Human)
  
  Details:
  Immunohistochemical analysis of paraffin-embedded human pituitary adenomas.
• Casar-Borota, O, Boldt, H B Et al. Corticotroph Aggressive Pituitary Tumors and Carcinomas Frequently Harbor ATRX Mutations. J Clin Endocrinol Metab 2021-03-25 [PMID: 33106857] (WB, ICC/IF, Human)
• Abboud D, Daly AF, Dupuis N et al. GPR101 drives growth hormone hypersecretion and gigantism in mice via constitutive activation of Gs and Gq/11 Nat Commun 2020-09-21 [PMID: 32958754] (IHC-P, Mouse)
• Neou M, Villa C, Armignacco R, et al. Pangenomic Classification of Pituitary Neuroendocrine Tumors Cancer Cell 2019-12-11 [PMID: 31883967]
• TjOrnstrand A, Casar-Borota O, Heurling K, et al. Lower 68 Ga-DOTATOC Uptake in Non-Functioning Pituitary Neuroendocrine Tumors Compared to Normal Pituitary Gland - a Proof-of-Concept Study Clin. Endocrinol. (Oxf) 2019-12-23 [PMID: 31868239]
• Capraru O, Gaillard C, Vasiljevic A et al. Diagnosis, pathology, and management of TSH-secreting pituitary tumors. A single-center retrospective study of 20 patients from 1981 to 2014 Annales d'Endocrinologie 2019-07-01 [PMID: 31400861] (IF/IHC, Human)
• You J, Li M, Cao LM et al. Comprehensive analysis of circulating microRNAs in plasma of patients with pituitary adenomas J. Clin. Endocrinol. Metab. 2019-05-21 [PMID: 31112271] (IF/IHC, Human)
• Scaroni C, Albiger N, Daniele A et al. Paradoxical GH increase during OGTT is associated to first-generation somatostatin analogs responsiveness in acromegaly. J. Clin. Endocrinol. Metab. 2018-10-03 [PMID: 30285115] (IF/IHC, Human)
• Maher M, Roncaroli F, Mendoza N et al. A patient with a germline SDHB mutation presenting with an isolated pituitary macroprolactinoma Endocrinol Diabetes Metab Case Rep 2018-07-21 [PMID: 30087776] (IF/IHC, Human)
• Albuquerque RFC, Carbonara CEM, Martin RCT et al. Parathyroidectomy in patients with chronic kidney disease: Impacts of different techniques on the biochemical and clinical evolution of secondary hyperparathyroidism Surgery. 2017-11-13 [PMID: 29146232] (Human)
• oystese KA, Zucknick M, Casar-Borota O et al. Early postoperative growth in non-functioning pituitary adenomas; A tool to tailor safe follow-up. Endocrine 2017-05-17 [PMID: 28516382] (Human)
• Manojlovic-Gacic E, Skender-Gazibara M, Popovic V et al. Oncogene-Induced Senescence in Pituitary Adenomas-an Immunohistochemical Study. Endocr. Pathol. 2015-11-14 [PMID: 26573928] (IHC-P, Human)
  
  Details:
  Pit1 antibody was used for the detection of pituitary-specific transcription factor 1 (Pit-1) protein in human pituitary adenoma tissue sections. The staining was performed on 5um TMAs using autostainer and the primary antibody was used at 1:500 dilution with Ultravision Detection System, Large Volume, Anti-Polyvalent HRP -DAB detection method.

Bioinformatics

• Gene Symbol: POU1F1