Pit1 Antibody

Immunohistochemistry-Paraffin: Pit1 Antibody [NBP1-92273] - Staining of human liver, pancreas, pituitary gland and tonsil using Anti-POU1F1 antibody NBP1-92273 (A) shows similar protein distribution across tissues to independent antibody NBP2-55357 (B).

Immunohistochemistry-Paraffin: Pit1 Antibody [NBP1-92273] - Staining of human pituitary gland shows moderate to strong nuclear positivity in neuroendocrine cells in the anterior lobe.

Immunohistochemistry-Paraffin: Pit1 Antibody [NBP1-92273] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: Pit1 Antibody [NBP1-92273] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.

Immunohistochemistry-Paraffin: Pit1 Antibody [NBP1-92273] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

• Reactivity: Hu, Mu, Rt
• Applications: IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Pit1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: CKLKAILSKWLEEAEQVGALYNEKVGANERKRKRRTTISIAAKDALERHFGEQNKPSSQEIMRMAE
• Specificity: Specificity of human Pit1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Predicted Species: Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: POU1F1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Control Peptide:

  Pit1 Protein (NBP1-92273PEP)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID:32958754)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Pit1 Antibody

• CPHD1
• GHF1
• GHF-1pituitary-specific positive transcription factor 1
• Growth hormone factor 1
• Pit-1
• PIT1pituitary-specific transcription factor 1
• POU class 1 homeobox 1
• POU domain class 1, transcription factor 1
• POU domain, class 1, transcription factor 1
• POU1F1a

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Pit1 Antibody (NBP1-92273)(12)

Publications using NBP1-92273

• Taniguchi-Ponciano K, Pena-MartInez E, Silva-Roman G et al. Proteomic and Transcriptomic Analysis Identify Spliceosome as a Significant Component of the Molecular Machinery in the Pituitary Tumors Derived from POU1F1- and NR5A1-Cell Lineages Genes Nov 27 2020 [PMID: 33261069] (IHC-P, Human)
  
  Details:
  Immunohistochemical analysis of normal/tumor human pituitary tissue.
• Taniguchi-Ponciano K, Andonegui-Elguera S, PeNa-MartInez E et al. Transcriptome and methylome analysis reveals three cellular origins of pituitary tumors Sci Rep Nov 9 2020 [PMID: 33168897] (IHC-P, Human)
  
  Details:
  Immunohistochemical analysis of paraffin-embedded human pituitary adenomas.
• Abboud D, Daly AF, Dupuis N et al. GPR101 drives growth hormone hypersecretion and gigantism in mice via constitutive activation of Gs and Gq/11 Nat Commun Sep 21 2020 [PMID: 32958754] (IHC-P, Mouse)
• Neou M, Villa C, Armignacco R, et al. Pangenomic Classification of Pituitary Neuroendocrine Tumors Cancer Cell Dec 11 2019 [PMID: 31883967]
• TjOrnstrand A, Casar-Borota O, Heurling K, et al. Lower 68 Ga-DOTATOC Uptake in Non-Functioning Pituitary Neuroendocrine Tumors Compared to Normal Pituitary Gland - a Proof-of-Concept Study Clin. Endocrinol. (Oxf) Dec 23 2019 [PMID: 31868239]
• Capraru O, Gaillard C, Vasiljevic A et al. Diagnosis, pathology, and management of TSH-secreting pituitary tumors. A single-center retrospective study of 20 patients from 1981 to 2014 Annales d'Endocrinologie Jul 1 2019 [PMID: 31400861] (IHC, Human)
• You J, Li M, Cao LM et al. Comprehensive analysis of circulating microRNAs in plasma of patients with pituitary adenomas J. Clin. Endocrinol. Metab. May 21 2019 [PMID: 31112271] (IHC, Human)
• Scaroni C, Albiger N, Daniele A et al. Paradoxical GH increase during OGTT is associated to first-generation somatostatin analogs responsiveness in acromegaly. J. Clin. Endocrinol. Metab. Oct 3 2018 [PMID: 30285115] (IHC, Human)
• Maher M, Roncaroli F, Mendoza N et al. A patient with a germline SDHB mutation presenting with an isolated pituitary macroprolactinoma Endocrinol Diabetes Metab Case Rep Jul 21 2018 [PMID: 30087776] (IHC, Human)
• Albuquerque RFC, Carbonara CEM, Martin RCT et al. Parathyroidectomy in patients with chronic kidney disease: Impacts of different techniques on the biochemical and clinical evolution of secondary hyperparathyroidism Surgery. 2017 Nov 13 [PMID: 29146232] (Human)
• oystese KA, Zucknick M, Casar-Borota O et al. Early postoperative growth in non-functioning pituitary adenomas; A tool to tailor safe follow-up. Endocrine May 17 2017 [PMID: 28516382] (Human)
• Manojlovic-Gacic E, Skender-Gazibara M, Popovic V et al. Oncogene-Induced Senescence in Pituitary Adenomas-an Immunohistochemical Study. Endocr. Pathol. 2015 Nov 14 [PMID: 26573928] (IHC-P, Human)
  
  Details:
  Pit1 antibody was used for the detection of pituitary-specific transcription factor 1 (Pit-1) protein in human pituitary adenoma tissue sections. The staining was performed on 5um TMAs using autostainer and the primary antibody was used at 1:500 dilution with Ultravision Detection System, Large Volume, Anti-Polyvalent HRP -DAB detection method.

Bioinformatics

• Gene Symbol: POU1F1