SEC24B Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: SEC24B Antibody [NBP1-86263] - Staining of human cell line A-431 shows localization to nucleoplasm & vesicles. Antibody staining is shown in green.

Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.

Staining of human pancreas shows very weak granular cytoplasmic positivity in exocrine glandular cells.

Staining of human tonsil shows strong granular cytoplasmic positivity in germinal and non-germinal center cells.

Staining of human testis shows strong granular cytoplasmic positivity in cells in seminiferous ducts.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SEC24B Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SEC24B Antibody - BSA Free (NBP1-86263) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SFQGAASSASHLHTSASQPYSSFVNHYNSPAMYSASSSVASQGFPSTCGHYAMSTVSNAAYPSVSYPSLPAGDTYGQMFTSQNAPTVR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SEC24B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SEC24B Protein (NBP1-86263PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SEC24B Antibody - BSA Free

• member B
• MGC48822
• protein transport protein Sec24B
• SEC24 family, member B (S. cerevisiae)
• SEC24
• Sec24-related protein B
• secretory protein 24

Background

The protein encoded by the SEC24B gene is a member of the SEC24 subfamily of the SEC23/SEC24 family, which is involved in vesicle trafficking. The encoded protein has similarity to yeast Sec24p component of COPII. COPII is the coat protein complex responsible for vesicle budding from the ER. The role of this gene product is implicated in the shaping of the vesicle, and also in cargo selection and concentration. Two transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SEC24B