SEC24B Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SEC24B Antibody [NBP1-86263] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & vesicles.
Immunohistochemistry-Paraffin: SEC24B Antibody [NBP1-86263] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SEC24B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SFQGAASSASHLHTSASQPYSSFVNHYNSPAMYSASSSVASQGFPSTCGHYAMSTVSNAAYPSVSYPSLPAGDTYGQMFTSQNAPTVR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SEC24B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SEC24B Protein (NBP1-86263PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SEC24B Antibody

  • member B
  • MGC48822
  • protein transport protein Sec24B
  • SEC24 family, member B (S. cerevisiae)
  • SEC24
  • Sec24-related protein B
  • secretory protein 24

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80789
Species: Hu
Applications: WB, IHC, IHC-P
MAB90551
Species: Hu, Mu, Rt
Applications: WB
NBP1-06529
Species: Hu
Applications: WB, IHC-P, IP, PLA
NBP1-81550
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58626
Species: Hu
Applications: WB, ICC/IF
NBP2-34842
Species: Hu, Mu, Rt, Ha
Applications: WB, Flow, ICC/IF, IP
NBP2-13742
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00009871-M04
Species: Hu
Applications: WB, ELISA
H00022908-D01P
Species: Hu
Applications: WB, ELISA, ICC/IF
MAB25031
Species: Hu
Applications: WB, IHC, IP
NB400-106
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92273
Species: Hu
Applications: IHC, IHC-P
NBP1-82456
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03381
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF4815
Species: Hu, Mu, Rt
Applications: WB, IHC
27570002
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP1-31874
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86263
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for SEC24B Antibody (NBP1-86263) (0)

There are no publications for SEC24B Antibody (NBP1-86263).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SEC24B Antibody (NBP1-86263) (0)

There are no reviews for SEC24B Antibody (NBP1-86263). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SEC24B Antibody (NBP1-86263) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SEC24B Products

Bioinformatics Tool for SEC24B Antibody (NBP1-86263)

Discover related pathways, diseases and genes to SEC24B Antibody (NBP1-86263). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SEC24B Antibody (NBP1-86263)

Discover more about diseases related to SEC24B Antibody (NBP1-86263).
 

Pathways for SEC24B Antibody (NBP1-86263)

View related products by pathway.

Blogs on SEC24B

There are no specific blogs for SEC24B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SEC24B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SEC24B