PRDM16/MEL1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PRDM16/MEL1 Antibody [NBP2-58350] - Staining of human cell line CACO-2 shows localization to nucleoplasm.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PRDM16/MEL1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KHEHENAPVSQHPGVLTNHLGTSASSPTSESDNHALLDEKEDSYFSEIRNFIANSEMNQASTRTEKRADMQIVDGS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRDM16
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PRDM16/MEL1 Recombinant Protein Antigen (NBP2-58350PEP)

Reactivity Notes

Mouse 86%, Rat 87%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for PRDM16/MEL1 Antibody

  • MDS1/EVI1-like gene 1
  • MEL1
  • MEL1KIAA1675PFM13MGC166915
  • PFM13
  • PR domain containing 16
  • PR domain zinc finger protein 16
  • PR domain-containing protein 16
  • PRDM16
  • Transcription factor MEL1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-48848
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-85525
Species: Hu
Applications: IHC, IHC-P, WB
H00000302-M02
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IP, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
MAB197
Species: Hu
Applications: CyTOF-reported, Flow, ICC, IHC, Neut
NBP2-92503
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB6158
Species: Hu, Mu
Applications: ICC, ICFlow, Simple Western, WB
NBP3-16249
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-33582
Species: Hu, Pm
Applications: ICC/IF, IHC, IHC-P
NBP2-01294
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-67635
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IP, WB
NBP1-04676
Species: Gt, Ha, Hu, Mu, Po, Rt, Sh, Sq
Applications: ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
203-IL/CF
Species: Hu
Applications: BA
NBP2-75453
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-P, IP, WB
NBP1-89105
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF1152
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-58350
Species: Hu
Applications: ICC/IF

Publications for PRDM16/MEL1 Antibody (NBP2-58350) (0)

There are no publications for PRDM16/MEL1 Antibody (NBP2-58350).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRDM16/MEL1 Antibody (NBP2-58350) (0)

There are no reviews for PRDM16/MEL1 Antibody (NBP2-58350). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PRDM16/MEL1 Antibody (NBP2-58350) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PRDM16/MEL1 Products

Bioinformatics Tool for PRDM16/MEL1 Antibody (NBP2-58350)

Discover related pathways, diseases and genes to PRDM16/MEL1 Antibody (NBP2-58350). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRDM16/MEL1 Antibody (NBP2-58350)

Discover more about diseases related to PRDM16/MEL1 Antibody (NBP2-58350).
 

Pathways for PRDM16/MEL1 Antibody (NBP2-58350)

View related products by pathway.

PTMs for PRDM16/MEL1 Antibody (NBP2-58350)

Learn more about PTMs related to PRDM16/MEL1 Antibody (NBP2-58350).
 

Research Areas for PRDM16/MEL1 Antibody (NBP2-58350)

Find related products by research area.

Blogs on PRDM16/MEL1

There are no specific blogs for PRDM16/MEL1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PRDM16/MEL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRDM16