PRDM14 Antibody

Images

 
Immunohistochemistry-Paraffin: PRDM14 Antibody [NBP1-86437] - Staining of human esophagus shows strong cytoplasmic positivity in squamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PRDM14 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ADASLLPEGLRTSQLLPCSPSKQSEDGPKPSNQEGKSPARFQFTEEDLHFVLYGVTPSLEHPASLHHAISGLLVPPDSSGSDSLPQTLDKDSLQLPEGLCLMQTVFGEVP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRDM14
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PRDM14 Protein (NBP1-86437PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PRDM14 Antibody

  • MGC59730
  • PFM11
  • PR domain containing 14
  • PR domain zinc finger protein 14
  • PR domain-containing protein 14
  • PRDM14
  • PR-domain zinc finger protein 14

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-235
Species: Hu, Mu, Po
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NBP1-91012
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
AF5415
Species: Hu
Applications: WB, IHC, ICC
NB100-56509
Species: Hu, Mu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-51843
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-545
Species: Hu
Applications: WB, IHC-P, IP
NB600-1287
Species: Hu, Mu, Rt
Applications: WB, Flow, IP, CyTOF-ready
H00388112-B01P
Species: Hu
Applications: WB, ELISA
AF949
Species: Hu, Mu
Applications: WB, Flow, IHC, IP, CyTOF-ready
NBP2-53281
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC-P
MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
NBP2-15840
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF6810
Species: Hu
Applications: WB, Simple Western, IHC

Publications for PRDM14 Antibody (NBP1-86437) (0)

There are no publications for PRDM14 Antibody (NBP1-86437).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRDM14 Antibody (NBP1-86437) (0)

There are no reviews for PRDM14 Antibody (NBP1-86437). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PRDM14 Antibody (NBP1-86437) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PRDM14 Products

Bioinformatics Tool for PRDM14 Antibody (NBP1-86437)

Discover related pathways, diseases and genes to PRDM14 Antibody (NBP1-86437). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRDM14 Antibody (NBP1-86437)

Discover more about diseases related to PRDM14 Antibody (NBP1-86437).
 

Pathways for PRDM14 Antibody (NBP1-86437)

View related products by pathway.

PTMs for PRDM14 Antibody (NBP1-86437)

Learn more about PTMs related to PRDM14 Antibody (NBP1-86437).

Blogs on PRDM14

There are no specific blogs for PRDM14, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PRDM14 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRDM14
Entrez